KEGG   Serratia marcescens WW4: SMWW4_v1c30130
Entry
SMWW4_v1c30130    CDS       T02448                                 

Gene name
impA
Definition
(GenBank) type VI secretion system protein ImpA
  KO
K11902  type VI secretion system protein ImpA
Organism
smw  Serratia marcescens WW4
Brite
KEGG Orthology (KO) [BR:smw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smw02044]
    SMWW4_v1c30130 (impA)
Secretion system [BR:smw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SMWW4_v1c30130 (impA)
SSDB
Motif
Pfam: ImpA_N DUF4197 Nitr_red_assoc
Other DBs
NCBI-ProteinID: AGE18807
Position
3251793..3252824
AA seq 343 aa
MAIDTDTLLAPVDADTPCGDNLEYDADFLAMARAATGKAEQQFGSTIIPEEAPDWVQVER
LASSLLARTKDLRVMLYLTRAWTQLRGLPGYADGLTLIHQAILRYWDALQPPLEFDGEAD
PLFRINALADLGDKAALAASVRAAPLLKSAAGEISLRDAGALLDGSKQECPNFPGGRARL
QDELAQQDRPEGALVMHIANTLAAIRSEVTRHLGESALPEMSALTKVFSLVALAGQSEAP
AATEADATQETAAEQPPAAVQSASAPLNWRSAQIQSRDDAQLMLDKVKNYFRLHEPSHPA
PLMIDRVQRLITLDFMQIVRDLAPDGLNQLETILGRPDHEENS
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggctatcgacaccgataccctgctggccccggttgacgcggacacgccctgcggcgac
aacctggaatacgacgccgactttctggccatggcgcgcgccgccaccggcaaagccgaa
cagcaattcggcagcaccatcattccggaagaagcgccggattgggtgcaggtcgagcgc
ctcgcaagctcgctgctggcgcgcaccaaagacctgcgcgtcatgctgtatctcacccgc
gcctggacccagctgcgcggattgccgggctatgccgacgggctgacgctgatccaccag
gcgatactccgctactgggatgccctgcagccgccgctggagttcgacggcgaggccgac
ccgctgtttcgcatcaacgcgctggccgaccttggcgacaaggccgcgctggccgccagc
gtgcgcgccgcgccgctgctgaaaagcgccgccggtgaaatctcgctgcgcgatgccggc
gccctgctcgacggcagcaagcaagagtgccccaactttcccggcggccgcgcacggctg
caggatgagctggcgcaacaggatcgccccgaaggcgcgctggtgatgcacatcgccaac
accctggccgccatacgcagcgaagtcacccgccatctgggtgaaagcgcgctgccggaa
atgagcgcgctgaccaaggtcttttcgctggtggcgctcgccggccagagcgaggccccg
gccgccaccgaagcggacgccacacaggaaaccgccgctgagcagccaccggccgccgtg
cagagcgcctctgccccactcaactggcgcagcgcgcagatccagtcgcgcgacgacgct
cagctgatgctggacaaggtgaaaaactattttcgtcttcatgagccaagccacccggcg
ccgctgatgatcgatcgggtacagcgactgattacgctggactttatgcaaatcgtccgc
gatttggcgcccgatgggcttaaccaactggagaccattctcggtcgccccgaccacgag
gagaacagctag

DBGET integrated database retrieval system