KEGG   Serratia marcescens WW4: SMWW4_v1c30140Help
Entry
SMWW4_v1c30140    CDS       T02448                                 

Gene name
impB
Definition
(GenBank) type VI secretion system protein ImpB
  KO
K11901  type VI secretion system protein ImpB
Organism
smw  Serratia marcescens WW4
Brite
KEGG Orthology (KO) [BR:smw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smw02044]
    SMWW4_v1c30140 (impB)
Secretion system [BR:smw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SMWW4_v1c30140 (impB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VipA Tricho_coat
Motif
Other DBs
NCBI-ProteinID: AGE18808
Position
3252947..3253483
Genome map
AA seq 178 aa AA seqDB search
MSNSKSRSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVMADLVGKAVDPQASVE
ERKFMEIDVDNFDERMKSLKPRVAYQVDNTLTGEGKLNIDLTFESMEDFSPAAIARKVDA
LDNLLDARTQLSNLLSYMDGKNGAEELISKILQNPALLKSLTDAPKPAVNDDNNERED
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaactcgaaatcccgcagcgggcagaaattcatcgcccgcaaccgcgcgccgcgc
gtacagattgaatacgatgtcgaaatttatggcgcagagcgcaaaatccagctgccgttc
gtgatgggcgtgatggcggatctggtggggaaagcggtcgatccgcaagccagcgtggaa
gagcgcaagttcatggaaatcgacgtcgacaacttcgacgagcgcatgaaatcgctgaag
ccgcgcgtcgcttatcaggttgacaataccctgaccggcgaaggcaagctgaacatcgat
ctgaccttcgaaagcatggaagacttctcccccgccgctatcgcccgcaaggtcgacgcg
ctggacaatctgctggacgcccgcacccagctttccaacctgctgtcctacatggacggt
aaaaacggcgccgaggagctgatctccaagatcctgcaaaacccggcgctgctgaaatcc
ctgaccgacgcgccgaagccggcggttaacgatgacaacaacgagcgtgaggattaa

DBGET integrated database retrieval system