KEGG   Serratia marcescens WW4: SMWW4_v1c30150
Entry
SMWW4_v1c30150    CDS       T02448                                 

Gene name
impC
Definition
(GenBank) type VI secretion system protein ImpC
  KO
K11900  type VI secretion system protein ImpC
Organism
smw  Serratia marcescens WW4
Brite
KEGG Orthology (KO) [BR:smw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smw02044]
    SMWW4_v1c30150 (impC)
Secretion system [BR:smw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SMWW4_v1c30150 (impC)
SSDB
Motif
Pfam: VipB VipB_2 DUF1877
Other DBs
NCBI-ProteinID: AGE18809
Position
3253487..3254992
AA seq 501 aa
MSNSPQQQNALQTTETFSSDEFSALLNKEFRPKTDQAKEAVENAVKTLAQQALENTVTVS
SDAYRTIQALIAEIDEKLSQQINQIIHHDDFQKLEGAWHGLHYLVNNSETDEMLKIRFMS
ISKQELGRTLKRYKGVGWDQSPIFKKIYEEEYGQFGGEPFGCLVGDYYFDHSPQDVELLG
EMAKIGAASHCPFIAGTAPSVMQMESWQELSNPRDLTKIFQNTEYAAWRSLRESEDARYL
GLVMPRFLARLPYGIRTNPVDEFDFEEDTDGATHGNYTWTNAAYAMAANINRSFKEFGWC
TAIRGVESGGAVENLPCHTFPSDDGGVDMKCPTEIAISDRREAELAKNGFMPLVHRKNSD
FAAFIGAQSLQKPAEYYDADASANAQLSARLPYLFACCRFAHYLKCIVRDKIGSFRERDD
MERWLNDWIMNYVDGDPANSSQETKSRKPLAAAEVQVEEIEDNPGYYSAKFFLRPHYQLE
GLTVSLRLVSKLPSLKQNDAS
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgagcaactcgcctcagcaacagaatgcgttgcaaaccaccgagactttttccagcgat
gagttcagcgcgctgttgaacaaagagttccggccgaagaccgatcaggccaaagaagcg
gtcgagaacgcggtgaaaacgctggcgcagcaggcgctggaaaataccgtcaccgtttct
tccgacgcctaccgcaccatccaggcgctgatcgcggaaatcgacgaaaagctgtcgcag
cagatcaaccagatcattcaccacgacgatttccagaagctggaaggcgcgtggcacggc
ctgcactacctggttaacaactctgaaaccgacgagatgctgaagatccgcttcatgagc
atttccaagcaggagctgggccgcacgctgaagcgttataaaggcgtgggctgggatcag
agcccgatcttcaagaaaatctacgaagaagagtatggccagttcggcggcgagccgttc
ggctgcctggtgggcgactactacttcgatcacagcccgcaggacgtggagctgctgggc
gaaatggccaagatcggcgccgcctcgcactgcccgttcatcgccggcaccgcaccgagc
gtgatgcagatggagtcctggcaggagctctccaacccgcgcgatctgaccaagattttc
cagaacaccgagtacgccgcctggcgcagcctgcgcgaatcggaagacgcgcgctacctg
ggcctggtgatgccgcgcttcctggcgcgcctgccgtatggcatccgcaccaacccggtg
gacgagtttgacttcgaagaagataccgacggcgcgacccacggcaactacacctggacc
aacgccgcctacgccatggccgccaacatcaaccgttcgttcaaagagttcggctggtgc
accgccattcgcggggtggaatccggcggcgcggtggagaacctgccgtgccacaccttc
ccgagcgacgacggcggcgtggacatgaagtgcccgaccgagatcgccatcagcgatcgt
cgcgaagccgagctggccaaaaacggctttatgccgctggtgcaccgcaaaaactccgac
ttcgccgcctttatcggcgcgcagtcgctgcagaagccggcggaatactacgacgccgac
gcctctgccaacgcccagctttccgcgcgcctgccgtacctgttcgcctgctgccgcttc
gcgcattacctgaagtgcatcgtgcgcgacaaaattggctccttccgcgagcgcgacgac
atggagcgctggctgaacgactggatcatgaactacgtggacggcgatccggccaactcc
tcgcaggaaaccaagtcgcgcaaaccgctggccgcggcggaagtgcaggtggaagagatt
gaagacaaccctggctactacagcgccaagttcttcctgcgcccgcactaccagctggaa
ggcttgaccgtttccctgcgcctggtgtcgaagctgccttcgctgaaacaaaacgacgcg
tcctga

DBGET integrated database retrieval system