KEGG   Serratia marcescens WW4: SMWW4_v1c30160
Entry
SMWW4_v1c30160    CDS       T02448                                 

Definition
(GenBank) type VI secretion system secreted protein Hcp
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
smw  Serratia marcescens WW4
Pathway
smw03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:smw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SMWW4_v1c30160
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smw02044]
    SMWW4_v1c30160
Secretion system [BR:smw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SMWW4_v1c30160
SSDB
Motif
Pfam: T6SS_HCP Rota_VP4_MID
Other DBs
NCBI-ProteinID: AGE18810
Position
3255297..3255779
AA seq 160 aa
MAIDMFLKVEGASGESKDSNHKGWTDITSFSWGASQPGNMGVGGGGGAGKVCFNDLHVNA
LIDKSTPALLKHCSSGKHLTKIELSVCKAGGTQVEYAKITLEDVLVTAVQYTGAGGEDTV
GVTYSFQAAKVKQQYWEQSDKGGKGAESSAGWNIKENREA
NT seq 483 nt   +upstreamnt  +downstreamnt
atggctattgatatgttcctgaaagttgaaggtgccagcggcgaatccaaagattcgaat
cacaaaggctggaccgacattacttctttctcctggggcgcttctcaaccgggcaatatg
ggcgttggcggcggcggtggcgccggtaaagtgtgcttcaacgatctgcacgtcaacgcg
ctgatcgacaagtcaaccccggccttgctgaaacactgctcaagcggcaaacacctgacc
aagattgagctgtcggtttgcaaggcgggcggcacccaggttgaatacgcaaaaatcact
ctggaagacgtgctggtcaccgccgtgcagtacaccggtgcaggcggcgaagacaccgtg
ggcgtcacctactccttccaggcggcgaaagtgaaacagcagtactgggagcagagcgac
aaaggcggcaaaggcgccgaaagcagcgcaggttggaacatcaaggaaaaccgcgaagct
taa

DBGET integrated database retrieval system