KEGG   Serratia marcescens WW4: SMWW4_v1c30220
Entry
SMWW4_v1c30220    CDS       T02448                                 

Definition
(GenBank) type VI secretion system, FHA domain-containing protein
  KO
K07169  FHA domain-containing protein
Organism
smw  Serratia marcescens WW4
Brite
KEGG Orthology (KO) [BR:smw00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    SMWW4_v1c30220
SSDB
Motif
Pfam: FHA UreE_N Yop-YscD_cpl
Other DBs
NCBI-ProteinID: AGE18816
Position
3259191..3260924
AA seq 577 aa
MRFSIVKNKSGQVPPQSSCDFLPPGGTIGRSVDNNLVLPDEERAISRLQAIVHISADGEC
RITNRGNVTRVLLNDIPLERGRQVELQDGDVLGIDDYQIEVSALQQHAAPQAQPVAKVAA
VAAAAAPAAAAKEKSAAPIPNEIWDSLVEEFTPNAPAAVTPPPIANPDNHPLLDTPAREL
NPADPLAQLAGDVDLRQLQQQQTDPAALFNTDSTFEREHILADTTPSALLAEQAAPPRPA
PPVQNAQQPEQELDPLALFGGSSAPASPETLNSNDPLGLLMGGAVPLAQPEEAVQPPSPP
PAPIAAQPVAPRPQPTPPPVQRPEPQPQPAPQFSQQEPPAQPPRPRQGNRLGIDPVAYQS
AQRQHAAAPNGDTLEGPLLTALLQGVGLDDLQPQPHFDEQQIRLAGRLLSLFSQGTVALL
SSRSILKRGVKAEMTMILDEANNPFKLLPSGKTVLMQMFGSQMPGFMPPEQAVRDALIDL
QAHQLGMIAGIRAIIAAMLQSFNPERLEEEARKEGVAPRLSLPANRKAALWDYFVKNYQQ
TSGEIEDDFHTLFGEAFLHAYDVEVNQYKDSQTKPDA
NT seq 1734 nt   +upstreamnt  +downstreamnt
atgcgattttccattgtaaaaaataaaagcggccaggttccgccgcagagcagttgcgat
tttctgccgccgggcggcaccatcggccgcagcgtggacaacaacctggtgctgccggac
gaagagcgcgccatttcccgcctgcaggcgatcgtgcatatttccgctgacggcgaatgc
cgcatcaccaaccgtggcaacgtcacccgcgtgctgctgaacgacattccgctggagcgc
ggccgccaggttgaactgcaggacggcgacgtgctcggcatcgacgattaccagatcgaa
gtcagcgcactgcagcaacacgccgcgccgcaggctcaaccggtggccaaggtcgccgcc
gttgccgctgctgcggcccctgcagccgccgccaaagaaaaatccgccgcgccgatcccc
aacgaaatctgggacagcctggtggaagaatttacgccgaacgcgccggccgccgtcaca
ccgccgccgatcgccaatccggacaatcatccgctgctggatacccccgctcgcgagctg
aacccggccgatccgctggcgcagctggcgggcgatgtcgatctgcgccaactgcagcaa
cagcaaaccgatccggccgccttattcaacaccgactccacttttgagcgtgagcatatc
ctggccgataccacccccagcgcgctgctggcggagcaggctgcgccgccgcgcccggct
ccccccgtccagaatgcgcagcaaccggaacaagagctggatccgctggcgctgttcggc
ggctcatccgcgcccgcttcgccagagacgctgaacagcaacgatccgctggggctgctg
atgggcggcgccgtgccgctggctcagccggaggaagcggtacagccgccgtccccacca
ccggcgccgatcgccgcccagccggtagcgccgcgccctcagccgacgccgccgcccgtg
cagagacccgagccgcaaccccaacccgcgccgcagttcagccagcaggaaccgcctgcg
cagccgccgcgtccgcgccagggcaaccgcctgggcatcgatccggttgcctaccagtcc
gctcagcggcagcacgccgccgcgccgaatggcgacaccttggaggggccgctgctgacg
gcgctgctgcaaggcgtcggtcttgacgatctgcagccgcagccacatttcgacgaacaa
cagatccgcctggccggtcgcctgctgagcctgttctcgcaaggcaccgtcgccctgctc
tcatcccgctcgatcctcaagcgcggcgtgaaggcggagatgaccatgatcctcgacgag
gccaacaacccgttcaagctgctgccttcgggcaaaacggtgctgatgcagatgttcggc
agccagatgccgggctttatgccgccggaacaggcggtgcgcgatgcgctgatcgacctg
caggcgcaccagctggggatgatcgccggcattcgcgccatcatcgccgccatgctgcag
tcgtttaacccggaacgtctcgaagaagaagcgcgcaaggaaggcgtggcgccgcgtctg
tcgctgcccgccaaccgcaaggccgcgctgtgggactacttcgtgaagaactatcagcaa
acctccggcgaaatcgaggacgatttccacaccctgttcggcgaagccttcctgcacgcc
tatgacgttgaagtgaatcaatacaaagactcacagaccaaaccggacgcgtaa

DBGET integrated database retrieval system