KEGG   Serratia marcescens WW4: SMWW4_v1c30260
Entry
SMWW4_v1c30260    CDS       T02448                                 

Gene name
impF
Definition
(GenBank) type VI secretion system protein ImpF
  KO
K11897  type VI secretion system protein ImpF
Organism
smw  Serratia marcescens WW4
Brite
KEGG Orthology (KO) [BR:smw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smw02044]
    SMWW4_v1c30260 (impF)
Secretion system [BR:smw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SMWW4_v1c30260 (impF)
SSDB
Motif
Pfam: GPW_gp25 DUF5600 DUF2113
Other DBs
NCBI-ProteinID: AGE18820
Position
3263552..3264127
AA seq 191 aa
MNDKRPPHYDGGDLRHQGYRYRQDSERLTSRDKMQPVLLDMLTDDEPQKKQEAQVRNLVS
HSELRRRVLRDLQWLFNCVNSESNLDLGDFPQVRRSTLNYGIASLAGKRMSDIEWLDIQR
ALTESILHFEPRILPEGLQVRCISDTGSLELHNVLSIEIKGRLWCVPYPLEFLFRTDVDL
ENGHFDLKDIG
NT seq 576 nt   +upstreamnt  +downstreamnt
atgaacgataagcgcccaccccactacgacggcggcgatctgcgccaccagggctatcgc
tatcgtcaggacagcgaacgcctgacctcgcgcgacaaaatgcagccggtgctgctcgat
atgctgaccgacgacgaaccgcagaaaaagcaggaggcgcaggtgcgcaacctggtgtcg
cacagcgagctgcgccgccgggtattgcgcgatctgcagtggctgttcaactgcgtcaac
agcgaatccaatctggatctcggcgattttccgcaggtgcggcgctccaccctgaattac
ggcatcgcctcgctggcgggcaagcgcatgtcggacatcgaatggctcgacattcagcgc
gcgctgaccgaatccattctccatttcgagccgcgcattttgcccgaggggctgcaggtg
cgctgcatctcggataccggctcgctggagctgcacaacgtgctgtcgatcgaaatcaag
ggccgcctgtggtgcgtgccctatccgctggagtttctgttccgtaccgacgtggatctg
gaaaacggccacttcgatctgaaagacatagggtaa

DBGET integrated database retrieval system