KEGG   Serratia marcescens WW4: SMWW4_v1c30280
Entry
SMWW4_v1c30280    CDS       T02448                                 

Gene name
impH
Definition
(GenBank) type VI secretion system protein ImpH
  KO
K11895  type VI secretion system protein ImpH
Organism
smw  Serratia marcescens WW4
Brite
KEGG Orthology (KO) [BR:smw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smw02044]
    SMWW4_v1c30280 (impH)
Secretion system [BR:smw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SMWW4_v1c30280 (impH)
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: AGE18822
Position
3266015..3267085
AA seq 356 aa
MSAEMIATELAPPQINALYRLPDDFWPRLRSAPYKHDLFQLLRRIDAQGGQPYLLGRAPL
PRHEMLRLGQEPSLSFAPSTLAQVAPRANSPLHDVSIFSFGLFGPNGPLPLHLTEYVRER
VYHHQDTTLLAFTNLFHHRLTLLFYRAWADAQPTVSLDRPDNRRFDEYLSSLIGIGQPAQ
QERDSINAHAKHFMAGHLIRHSRDPEGLSKILQQYFKVPVRIVENVPHWLRVEPREQARL
KAGRGAPRLGESAFLGIAVRDIQHKFRIELGPMPQQDYDRFLPGAELCRQLRDWVRQYLG
IEFVWEVRLILAKEQAHGIQLGGAQRLGLSSWLADHRRQRDLDDLIFSPEPLENPF
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgagcgcggagatgatcgccaccgaactggcgccgccgcagatcaatgcgctgtatcgg
ctgccggacgacttctggccgcggctgcgcagtgcgccttacaagcacgatctgtttcaa
ctgctgcgacgcatcgacgcccagggcggccagccctatctgctggggcgcgcgccgctg
ccgcgccacgagatgctgcgcctgggccaggagccgtcgctgtcgttcgcgccctccacg
ctggcgcaggtggcgccacgcgccaacagcccgctgcacgacgtttcgatcttcagcttc
ggcctgttcggccccaacgggccgctgccgctgcacctgaccgaatacgtacgcgaacgg
gtgtaccaccatcaggacaccaccctgctggcgttcaccaacctgttccatcaccggctg
acgctgctgttttaccgcgcctgggccgacgcgcagccgacggtatcgctggatcgcccg
gacaaccggcgcttcgacgagtatctgtcgagcctgatcggcatcggccagccggcgcaa
caggagcgcgacagcatcaacgcccacgccaagcattttatggccggtcatctgattcgc
cacagccgcgatccggaaggcctgagcaagattttgcagcagtatttcaaggtgccggtg
cgcatcgtcgaaaacgtgccgcactggctgcgggtggaaccgcgcgaacaggcgcggctc
aaggccgggcgcggtgcgccgcggctcggcgagtcggcctttctcggcatcgcggtgcgc
gatatccagcacaagttccgcatcgagctggggccgatgccgcagcaggactatgaccgc
ttcctgccgggcgccgagctgtgccggcaactgcgcgactgggtgcgccaatacctgggc
atcgagttcgtctgggaagtgcgcctgatcctggcgaaggaacaggcgcacggcatccag
ctcggcggcgcgcagcgattgggcctgagcagttggctggccgaccatcggcgacagcgc
gatctcgacgatctgatcttcagccctgaaccgctggaaaacccgttctga

DBGET integrated database retrieval system