KEGG   Serratia marcescens WW4: SMWW4_v1c30290
Entry
SMWW4_v1c30290    CDS       T02448                                 

Gene name
vasG
Definition
(GenBank) type VI secretion system protein VasG
  KO
K11907  type VI secretion system protein VasG
Organism
smw  Serratia marcescens WW4
Pathway
smw03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:smw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SMWW4_v1c30290 (vasG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smw02044]
    SMWW4_v1c30290 (vasG)
Secretion system [BR:smw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SMWW4_v1c30290 (vasG)
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA ClpB_D2-small AAA_5 AAA_16 Sigma54_activat AAA_22 AAA_7 AAA_25 AAA_14 TniB ATPase_2 Clp_N NACHT Zeta_toxin AAA_18 IstB_IS21 TSKS TIP49 Hpr_kinase_C T2SSE Torsin CbiA DUF815 DUF853 AAA_6
Other DBs
NCBI-ProteinID: AGE18823
Position
3267142..3269799
AA seq 885 aa
MSEISRSVLFGKLDSLLFTSLESATAFCKLRGNPYVELAHWLHQLMQSPDGDLQQIVRHF
ALDEAQLARDIVEALDRLPRGASAISDLSEHIDSAVERAWVYGSLKFGAARIRGGHLLLG
ILKTYSLRHLLKAISPQFERINADLLMEQFAVITAHSAENAQDAPAESRAENASGAARSG
ESVLAQYAQDLTARARDGEIDPVAGRDEEIRQIIDILMRRRQNNPLLTGEAGVGKTAVVE
GLALRIVAGDVPPQLRDVKLCLLDIGMLQAGAGVKGEFEKRLQAVIDEVQSSPTPIILFI
DEIHTLIGAGGAQGTGDAANLLKPALARGQLRTIGATTWSEYKKYIEKDPALTRRFQVVQ
VHEPSEDKALLMLRSTVSPLEQHHRVLLLDEAVDAAVRLSHRYIPARQLPDKAVALLDTA
CARVAVSQHAEPAQVEDCRHRIDALQIELDIARREAKVGIGDPLRPQEIEAQLTALRLEL
KQLTERWQQELTLIQEIITLRAQLHRQEAEEPAGEETEAGPDADALRAQLGELQQQLSAL
QGEAPLIFAAVDANIVAAVVADWTGIPLGRMVKNEIEAVLQLSATLNQRVIGQRHALDLI
ARRVRTSRARLDDPNKPVGVFLLAGPSGVGKTETALALAETLYGGEQNVITINMSEFQES
HTVSTLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEIEKAHPDVHEIFFQVFDKGWME
DGEGRHIDFRNTIIILTSNVGTDLIAGLCSDPELLPEPEALSGALRQPLLSVFPAALLGR
LLVVPYYPLTDATLGNIVRLQLGRIQRRLAENHDIVCTFDDAVIEQIVSRCTEVESGGRM
VDAILTNTLLPQISHTLLTGSANDQRYRQLHIALQNHEFICQFQA
NT seq 2658 nt   +upstreamnt  +downstreamnt
atgtctgaaatcagccgctcggtattatttggcaaactggatagcctgttattcacctct
ctggaaagtgcgacggcgttttgcaagctgcgcggtaacccctacgtcgaattggcgcac
tggctgcatcagctgatgcaatcgccggacggcgatctgcagcagatcgtccgccacttc
gcgttggacgaggcgcagctggcgcgcgacatcgtcgaggcgctcgatcgcctgccgcgc
ggcgccagcgccatctccgatctgtccgagcacatcgacagcgcggtagaacgcgcctgg
gtctatggctcattgaaattcggcgcggcgcgcatccgcggcggccacctgctgctcggc
attctgaaaacctacagcctgcgccatctgctgaaggccatttccccgcagttcgagcgc
atcaacgccgatctgttgatggagcagttcgccgtcattaccgctcactcggcggaaaac
gcccaggatgcgccggcggaaagccgcgccgagaacgcatccggcgcggcgcgcagcggt
gaaagcgtgctggcgcagtatgcccaggatctgaccgccagagcgcgcgacggcgagatc
gacccggtggccggccgcgatgaagagatccggcaaatcatcgatatcctgatgcgccgc
cgccagaacaacccgctgctgaccggtgaggccggcgtcgggaaaaccgcggtggtggaa
ggcctggcgctgcgcatcgtggccggcgatgtgccaccacagctgcgcgacgtgaaactg
tgcctgctggacatcggcatgctgcaggccggcgccggcgttaagggcgagtttgaaaaa
cggctgcaggcggtgatcgacgaagtgcagtccagcccgacgccaatcatcctgtttatc
gacgaaattcacaccctgatcggcgccggcggcgcccagggcaccggcgacgccgccaac
ctgctgaagccggcgctggcgcgcggccaactgcgcaccattggcgccaccacctggtcg
gaatacaagaaatacatcgagaaagacccggcgctcacccgccgtttccaggtggtgcag
gtgcacgaaccgagcgaagacaaagcgctgctgatgctgcgcagcaccgtcagcccgctg
gagcaacaccaccgcgtgctgctgctggatgaagcggtggacgccgcggtgcggctgtcc
catcgctatattccggcccgccagttgccggacaaggcggtggcgctgctggataccgcc
tgcgcgcgcgtggcggtcagccaacacgccgaacccgcccaggttgaagactgccgccat
cgcatcgatgcgctgcagatcgaattggatatcgcccgccgcgaggccaaggtcggcatc
ggcgatcccctgcgcccgcaggagattgaagctcagctgaccgcgctgcgcctggagctc
aaacagctgaccgagcgctggcagcaagagctgacgctgatccaagagatcatcacactg
cgcgcccagctgcaccggcaggaagcggaggagcctgccggcgaagaaacggaggcgggc
cctgacgccgacgcgctgcgcgcccaactgggcgagctgcagcagcaactgagcgcgctg
cagggcgaagcgccgctgatcttcgccgccgtcgacgccaacatcgtggcggcggtggtg
gccgactggaccggcatcccgctgggccgcatggtgaaaaacgagattgaagcggtgctg
caactctccgccaccctgaaccagcgcgtcatcggccaacgccatgcgctggatctgatc
gcccgccgggtgcgcacctcacgggcgcggctggacgatccgaacaagccggtcggggtg
ttcctgctggccgggccctccggcgtcggcaaaaccgaaaccgcgctggcgctggcggaa
accctgtatggcggcgagcagaacgtcatcaccatcaacatgagcgaattccaggagtcg
cacaccgtttcgacgctgaaaggcgcgccgcccggctatgtcggctacggcgaaggcggc
gtgctgaccgaggcggtgcgccgccgtccttacagcgtggtgctgttggacgagatcgag
aaagcgcacccggacgtccatgaaatcttcttccaggtgttcgacaagggctggatggag
gacggcgaaggccgccatatcgatttccgcaacaccatcatcatcctgacctccaacgtc
ggcaccgatctgatcgccgggctgtgcagcgatccggagctgctgccggagccggaggcg
ctgagcggcgcgctgcgccaaccgctgctgtcggtgttcccggccgccttgctcggccgc
ctgctggtggtgccgtattacccgctgaccgacgccacgctgggcaacatcgtgcgcctg
cagttgggccgcattcagcgccgtctggcggagaatcacgacatcgtctgcaccttcgac
gacgcggttatcgagcagatcgtcagccgctgcaccgaggtggagtccggcggccgcatg
gtcgacgccatcctgaccaacaccctgctgccgcagatcagccacaccctgctgaccggc
agcgccaacgaccagcgctatcgccagctgcatatcgcgctgcagaaccacgaattcatt
tgtcaatttcaggcataa

DBGET integrated database retrieval system