KEGG   Serratia marcescens WW4: SMWW4_v1c30310
Entry
SMWW4_v1c30310    CDS       T02448                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
smw  Serratia marcescens WW4
Pathway
smw03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:smw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SMWW4_v1c30310
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smw02044]
    SMWW4_v1c30310
Secretion system [BR:smw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SMWW4_v1c30310
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Gp5_C
Other DBs
NCBI-ProteinID: AGE18825
Position
3271436..3273364
AA seq 642 aa
MLDRIIAHTPLGQEQLLFRSLDGIEALSTPFDFSIELLSTDARLDRKALLGQPLTLEIPT
QGFLSAPRYLNGKITAIAVSSEEIGGTRYAVYNLHVQPDLWPMTKDRNFRIFQEQTVPQI
VKTLLAEHNVQLEDQLTGDYRLWGYCVQYNESSFNFISRLMELEGIYYYFKHEMGKHTLV
LGDAPHHHQPYPGYEMIPYHLTPSGGSTSEEGISQWTLSDRVTPGIYSLDDYDFRKPNAW
LFQARQNPVSPTPGQIDVYDWPGRYTEHQQGEFYARVRQEAWQAEHQQIRGTATAMGIAP
GSTFTLYNAPHADDNREYLTLQANYHLKENRYASGDDQSSEHRIDFTVLPADVPWHPPQQ
ASWPKTHGPQTARVVGPAGESIWTDKYGRIKVKFHWDRFGPKDDGSSCWVRVSSAWAGQG
YGGVQIPRVNDEVVVDFINGDPDRPIVTGRVYNEASMPPWALPAAATQMGFMSRTKDGTA
DNANALRFEDKAGAEQVWIQAERNMDTQVKNDESHTIANDHTHLVGGNQIKRVVLNQATG
VKGESSALTGKTRSDAVVNAFTLGSGESLRLECGESVIELLADGQINITGTSFNITVKED
GAINTGGQLDLNQPGGAARTAAPGGGHQAAIQSAVDQLFPKE
NT seq 1929 nt   +upstreamnt  +downstreamnt
atgttggatcgcattattgcgcacacgccgctgggccaggagcaactgctgttccgctcg
ctggacggcatcgaagcgctttccactcctttcgacttctctattgaattgctgagcacc
gacgcgcggctcgatcgcaaagcgctgctcggccaaccgctgacgctggagatccctacc
cagggctttctcagcgccccgcgctacctgaacggcaagatcaccgccatcgccgtcagc
agcgaagagatcggcggcacgcgctacgcggtgtataacctgcacgtgcagccggatctg
tggccgatgaccaaagaccgcaacttccgcatcttccaggaacagacggtgccgcagatc
gtcaagaccctgctggcggagcacaacgtgcagctggaagatcagctgaccggcgactat
cgcctgtggggctactgcgtgcagtacaacgaaagcagcttcaacttcatcagccgcctg
atggagctggagggcatctattactatttcaaacacgagatgggcaagcacacgctggtg
ctcggggatgcgccccaccaccaccagccttatcccggctacgagatgatcccctaccat
ctgacgccgtccggcggcagcaccagcgaggaaggcatcagccagtggacattgtccgat
cgcgtcacgccgggcatctacagcctggacgactatgattttcgcaaacctaacgcctgg
ctgttccaggcgcggcaaaacccggtctcccccacgccggggcagatcgacgtttacgac
tggccaggccgctataccgagcatcagcaaggggagttctacgcccgcgtgcgccaggaa
gcctggcaggccgagcatcagcagatccgaggcaccgccaccgccatgggcatcgccccc
ggcagcacctttacgttgtataacgccccgcacgccgacgacaaccgcgagtacctgacg
ctgcaggccaactatcacctgaaagagaaccgctacgccagcggcgacgatcagagtagc
gaacaccgtatcgacttcaccgtgctgccggcggacgtgccctggcacccgccgcagcag
gccagctggccgaaaacccacgggccgcagaccgcccgggtggtcggcccggccggcgaa
tcgatctggaccgataaatacggccgcatcaaggtgaaattccactgggatcgcttcggg
ccgaaagacgacggcagctcctgctgggtgcgcgtctccagcgcctgggccggccagggc
tacggcggtgtgcagatcccgcgcgtcaacgacgaagtggtggtggactttatcaacggc
gatccggatcggccgatcgtcaccgggcgcgtctataacgaagccagcatgccgccgtgg
gcgctgccggccgccgccacccagatgggctttatgagccgcaccaaggacggcaccgcc
gacaacgccaacgccctgcgtttcgaagacaaggccggcgccgagcaggtgtggatccag
gcggagcgcaacatggacacccaggtgaaaaacgatgagagccacaccatcgctaacgac
cacacccacctggtgggcggcaaccagatcaagcgggtggtgctcaatcaggccaccggc
gtcaaaggcgaatcctccgcgctgaccggcaaaacgcgcagcgacgccgtggtcaatgcc
tttaccctcggctccggcgaatcgctgcggctcgagtgcggcgaaagcgtgatcgaactg
ctggcggacggccaaatcaacatcaccggcaccagtttcaatatcacggtgaaagaggat
ggcgcgatcaacaccggcggccagctggatctcaaccagcctggcggcgccgcacgcacc
gccgcaccgggtggcggccatcaggcggcaatccagagcgccgtcgatcagttgttccct
aaagagtag

DBGET integrated database retrieval system