KEGG   Serratia marcescens WW4: SMWW4_v1c31450
Entry
SMWW4_v1c31450    CDS       T02448                                 

Definition
(GenBank) type VI secretion protein IcmF
  KO
K11891  type VI secretion system protein ImpL
Organism
smw  Serratia marcescens WW4
Pathway
smw03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:smw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SMWW4_v1c31450
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smw02044]
    SMWW4_v1c31450
Secretion system [BR:smw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SMWW4_v1c31450
SSDB
Motif
Pfam: IcmF-related IcmF-related_N IcmF_C AAA_16 AAA_19 AAA_29
Other DBs
NCBI-ProteinID: AGE18939
Position
complement(3387021..3390500)
AA seq 1159 aa
MIRRSFILVIALLLCAVVWWIGTLIAIGTYRPLLSVWVRGIIIALILCWALWPFVATFLS
WVFRHARAPAPAKRKTAQRDRVTSRFYDALRTLQYVGTAKQRTPWQRFKYRLTRRYVSEK
PWFLVIGPPGSGKTSLIGESGERFLLAEHYGLQQTVDVGPTQDCNWWLAENSVYVDTSGE
WLQLNGLGEEGARARDTLFKLIRRHRRHPGIDGIMLCLDARWLLHASLTERKSVADALRV
RLLEMASWFRSELPVYLTISHLDQLVGGETFLSMLGDDLLQKGMGFSLNRAEQGETPFEQ
YETLYREMVARVSHHVLELLHDAPDGQNRQQLLFFTESLGSLGNPLYSLLEQIFPQTPVG
YACHLQQVWLGSTIALSPQGAIYNAEAADIYEARPTGRIYHPELDYARQERGVMQQSSHA
RPLGSRMSSLGRYVLVLILLAVSFNLLAMRYLWESDYISYIAARFDETKRIVREIPVTNR
VSDDVISAYEQLGYMNAQLGGEVSPVPNPYFEHKLINSAAQKTYQRHLLQIFWPAVENYI
ADELKNDVSASNKDVYGTLKVYLMMGEPSHRSAEALVDWFMARWETFMPQGYTDMNKGIF
AYHLREMFSLPDAPVMKMNGDLLRLARVKAMNIPMQVRVVRRIEEKPLPAAINDISLADA
AGPNVSLMLRRKSQATVTDTAVPGFYTRASYRDVFLAQLDDAAKDMIEEESWVLRDSGEG
KNAVNSLASAQKLADEARKLYLIEYADKWDAFMRDVRARPVNGLEDAAILARQLSDPSSP
LANLVRFAARETSMTGTNQGDAASWFDRQRNRIEQQRRDILGEISGERARFRLTPERAVE
DRFELLRRLGYQLLQTTNASNDPLSRSFEALYSQLTTLSTSLRGGQVVPAGGTLKRLQLD
AARQPEPVRSVMMDLLQVGDSQTIQQSQKNLSKGASSLASGLCKSSISGRYPFSRNARAE
VGIEDFSRMFGQSGAMQQFFDENLAPYVDVNAQKWNAKPGSEGIVNASTLGAFENARLIR
DTFFTAGDKLSFSMFIRPLSLTPTITEATLDIDGQVINYSHGFSQPTRIDWPGPKGGSYV
RLTFRTGTGQIQVASFDGPWALFRMFDASNPVPLASDRRELTMSMSSVVGVLKLELRSTM
KDFPLWSRALRGFSCPKAM
NT seq 3480 nt   +upstreamnt  +downstreamnt
atgatacgtagatcattcatattggtgattgccttgctgctgtgtgcggtggtgtggtgg
attgggacgttgatcgccatcggcacctatcggccgctgctgtcggtctgggtcaggggc
atcatcatcgcgctgatcctgtgctgggcgctgtggccgttcgtggcgacgttcttatcc
tgggtgttccgccacgcgcgagcgccggccccggccaaacgcaagaccgcccagcgagat
cgcgtgacctcgcgcttttacgacgctttgcgcaccttgcagtacgtcggcacggcgaag
cagcgcaccccctggcagcgcttcaaataccgcctgacgcgccgttacgtcagcgaaaag
ccgtggtttctggtcatcgggccgccgggcagcggcaaaacctcgctgatcggcgaaagc
ggcgaacgcttcttgctggccgagcactatggcctgcagcagacggtggacgtcgggccg
acccaggattgcaactggtggctggcggagaattcggtgtatgtcgacacttccggcgaa
tggctgcagttgaacggtctgggggaagagggcgccagggcgcgcgacaccctgttcaaa
ctgatccgccgccatcgccgccatccgggcatcgacggcatcatgctgtgtcttgatgcg
cgttggttgctgcacgcctcgctgacggagagaaagtcggtcgccgacgcgctgcgcgtg
cgcctgctggagatggcctcgtggttccgcagcgagctgccggtctatcttaccatcagc
cacctcgatcaactggtcggcggcgagaccttcctgtcgatgctgggcgacgatctgttg
caaaaaggtatgggcttcagcctgaaccgcgccgaacagggagaaacccccttcgaacag
tatgaaaccctctaccgggagatggtggcgcgcgtcagccatcacgtgctcgaactgttg
cacgatgcgccggacggccaaaaccgccagcagctgctgttcttcaccgagtcgctgggg
tcgctgggcaacccgctgtattccctgttagagcagatcttcccgcaaacgccggtgggc
tacgcctgccatctgcagcaggtgtggctgggcagcaccatcgccttgtcgccgcagggg
gcgatctacaacgcggaagcggcggatatctatgaagctcgcccgaccgggcgcatttat
cacccggagctggattacgcccggcaagaacgcggggtgatgcagcagtcttcgcacgcc
aggccgctcggcagccgcatgagctccctgggccgctatgtgctggtgctcattctgttg
gcggtctcgtttaatctgctggcgatgcgttacctgtgggagagcgattacatctcctac
attgcggcgcgcttcgatgagacaaaacgcatcgtgcgggaaattccggtgactaaccgc
gtcagcgacgatgtcatttccgcctatgagcagctgggctacatgaacgcgcaattgggc
ggcgaagtgtcgccggtgccgaatccctatttcgagcacaagctgatcaacagcgcggcg
caaaaaacctaccaacgccatttgctgcagatcttctggccggcggtggaaaactatatc
gcggacgaactcaagaatgacgtctcggcgtccaacaaggacgtctacggcaccctgaaa
gtgtacctgatgatgggcgaaccttcgcatcgctccgccgaagccttggtcgactggttc
atggcgcgctgggaaacctttatgccgcaggggtacaccgatatgaacaaaggcatcttc
gcttaccatctgcgggagatgttctctttgccggacgcgccggtcatgaagatgaacggc
gatctgctgcgcctggcgcgggtgaaagcgatgaacattccgatgcaggtgcgggtggtg
cgccgcatcgaagagaaaccgctgccggcggcgatcaacgatatttcgttggccgacgcc
gccggaccgaacgtctccttgatgctgcgccgcaagagccaggcgacggtcaccgatacc
gccgtgccggggttctatacccgcgccagctatcgcgacgttttcctggcgcagctcgat
gacgccgccaaggacatgatcgaagaagagtcctgggtgctgcgcgacagtggggaaggg
aaaaacgcggtgaactcgctggcctcggcgcagaagctggccgacgaggcgaggaagctt
tacctcatcgagtatgccgacaaatgggatgcgttcatgcgcgacgtgcgcgcccggccg
gtcaacgggcttgaggatgcggcgatcctggcgcgtcaactgtccgatccttcttctcca
ctggccaatctggtgcgtttcgccgcgcgcgaaaccagcatgaccggcaccaaccagggc
gatgcggcaagctggttcgatcgccagcgcaaccgcatcgagcagcagcggcgcgacatt
ctgggcgagatttccggcgagcgcgcgcgttttcgtctcacgccggagcgcgcggtggaa
gatcgcttcgagctgctgcgccgtctgggctatcagctgttgcagaccaccaacgccagc
aacgatccgctgagccgcagtttcgaagcgctgtacagccagttgaccaccttgtccacc
tcgctgcgcggcggccaggtggtgcccgccgggggcacgctgaagcgcctgcagctggat
gcggcgcgccagccggaaccggtgcgcagcgtgatgatggatctgttgcaggtcggggac
agccagacgattcagcagagccagaagaacctgagcaaaggcgcttcgtcgctggcctcc
ggcttgtgcaagagcagcatcagcgggcgttatccgttctcgcgcaacgccagagcggag
gtcggcatcgaggacttctcgcgcatgtttggccaaagcggcgcgatgcagcagttcttc
gatgagaacctggccccttatgtggacgtcaacgcgcagaaatggaatgccaaaccgggt
tcagaggggatcgtcaatgccagcacgctgggcgcgtttgaaaatgcccgcctgatccgc
gataccttcttcaccgccggcgacaagctgtctttctccatgttcatcaggccgttgtcc
ctgacgccgactattacggaagcgaccctggatatcgatgggcaggtgattaactacagc
catggcttcagccagcctacccgtatcgattggccgggcccgaaaggcggcagctatgtt
cgactcaccttccgcaccggcaccggccagatccaggtcgccagtttcgacgggccctgg
gccttgttccggatgttcgacgccagcaatcccgtgccgctcgccagcgacaggcgagag
ctgacgatgtcgatgtcgtcggtggtgggcgtgctcaaactggaattgcgctcgacgatg
aaagatttcccactttggtcacgggcgttgcgaggattctcgtgcccgaaagcgatgtaa

DBGET integrated database retrieval system