KEGG   Serratia marcescens WW4: SMWW4_v1c31470
Entry
SMWW4_v1c31470    CDS       T02448                                 

Definition
(GenBank) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
smw  Serratia marcescens WW4
Brite
KEGG Orthology (KO) [BR:smw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smw02044]
    SMWW4_v1c31470
Secretion system [BR:smw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SMWW4_v1c31470
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: AGE18941
Position
complement(3392044..3393402)
AA seq 452 aa
MLPKQRVAWVEGMLMEPQHFQQQERFFEHLIEARLRSVETFTWGFLTLEIDNGLLEQGKF
ALKKAKGVFPDGTAFSMPEDIPLPPPLVLGEGCQGKVVCLSVLMDIAGNAQIDLIQDARK
SSRFRTMDAEVPDRNHGVSLEGTPRVCTMQLGSLVTRLSLEDAVSSAESVLPVGFVRELT
SDRRVLLDERALPPMLDFRAIGWLPAFTTELLGLISQRLESVFRPDVHMTIGGLSELLEL
LLLQTLSEFNLRISQLLASPQVHPETLFDTLLSLLGRLSIIPGGERLWDRADLVYLHDEP
HNCYFQLFASIRRALSLVIEAPAVALPFVDRGDSIYLCPNDSQLRLEKLVFAVSCGLSIE
HLRSYFPAQVKLGPVEKIIQLIDLQLPGARLLPMASPPRHIPYYPNSIYFEVDHADPIYK
EMMAGSAMALSIVGDFPDLRFDVWGLRQGRVG
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgttacctaaacaacgcgtcgcctgggtagaaggcatgttgatggaaccgcagcatttc
cagcagcaggaacgttttttcgagcacttgattgaagcgcgcttgcgcagcgtcgaaacc
ttcacctgggggttcctgacgctggagatcgacaacgggctattggaacagggcaagttt
gcgctgaagaaagccaagggcgttttccccgacggcacggcgttcagcatgcctgaggat
ataccgctgccgccgccgctggtgctgggagaaggctgccaggggaaagtggtgtgcctg
tccgtgctgatggacatcgccggcaacgcccagatcgatcttatccaggatgcgcgaaaa
agcagccgttttcgcaccatggacgccgaggtgccggatcgcaaccacggcgtcagcctg
gaagggaccccgcgcgtgtgcacgatgcaactgggcagcctggtgacgcggctaagcctg
gaggacgcggtcagcagcgcggaaagcgtgctgccggtcggtttcgtgcgcgagctgacc
agcgatcgtcgggtgctgctggatgagcgcgccttgccgccgatgctggatttccgcgcc
atcggctggctgcccgctttcaccaccgaattgcttgggctgatcagccagcgtctggag
tcggttttccgcccggacgtgcatatgacgatcggcgggctttccgagctgctggagttg
ctgttgctgcaaaccttgagcgagttcaatttgcgcatcagccaactgctggccagcccg
caggtgcatcctgaaaccctgttcgacacgttgctgagcctgctggggcggctcagcatc
attcccggcggcgaacgcctctgggatcgggccgatttggtgtatctgcacgatgagccg
cacaactgctacttccagctcttcgcctcgattcgccgcgcgctgtcgctggtgatcgaa
gcgccggcggtggcgttgccgtttgtcgatcgcggcgacagcatttatctgtgcccgaac
gactcgcagctgcgcctggaaaaactggtgttcgccgtcagctgcggtttgtccatcgag
catctgcgctcgtatttccccgcgcaggtcaaactggggccggtcgagaaaatcattcag
ctgatcgatctgcaattgccgggcgctcgcttgttgccgatggcttcgccgccgcggcac
ataccgtattacccgaacagcatctatttcgaggttgatcatgccgacccgatttataag
gaaatgatggccggctcggcgatggcgctcagcatcgtgggtgatttccccgacctgcgt
tttgacgtctggggattaaggcaagggagggtgggatga

DBGET integrated database retrieval system