KEGG   Serratia marcescens WW4: SMWW4_v1c31540
Entry
SMWW4_v1c31540    CDS       T02448                                 

Gene name
clpV
Definition
(GenBank) type VI secretion ATPase, ClpV family
  KO
K11907  type VI secretion system protein VasG
Organism
smw  Serratia marcescens WW4
Pathway
smw03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:smw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SMWW4_v1c31540 (clpV)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smw02044]
    SMWW4_v1c31540 (clpV)
Secretion system [BR:smw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SMWW4_v1c31540 (clpV)
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA AAA_5 AAA_16 ClpB_D2-small Clp_N AAA_22 Sigma54_activat AAA_25 IstB_IS21 NACHT ATPase_2 AAA_18 AAA_7 ResIII Zeta_toxin CbiA RuvB_N TniB AAA_6 Hpr_kinase_C EzrA Torsin FAM167
Other DBs
NCBI-ProteinID: AGE18948
Position
complement(3400607..3403192)
AA seq 861 aa
MYQRERLFSRLGHFAYQSFVEATKLCRTFRHEYVELEHWLKVLVDKERGDLPLILAHYAI
NSQRISDALDRILHTLPNRTNAVVDLSTQLETVVERGLLMSQLAETPSGGVRTIHILVGI
LQDPTLQRSLYRLSDEFKKLPIPQLFDDYPAILAESVEHEEEEEEVYSAHGDAPEASETV
DILDKWCADLTRQARDGEIDPVIGREAELRQVIDILLRRRQNNPILVGEAGVGKTAVAEA
LACKIAQGQVPPLLQGARLLSLDLGRMQAGASMRGEFESRLKALIDAIAHSAVPVILFCD
EAHTLVGAGGQAGTGDAVNLLKPMLARGALRMVAATTWSEYKQFIEPDAALTRRFQYVLV
SEPDEENAVNMMRAIAPHFAQHHSVKIRESALQAAVHLSLRHLPSRQLPDKAISLLDTAC
ARVALSQHALPEKIESLEAGLAVKRTEMNGLQEESKFDDLALSRITELQQTLSDMEGELA
ALRQRQAQEQQAVTTLLDAERQSPERLPQLASELGALQDGGLPLVYPWVDDRVVAEVLSD
WTGIPTGRMLQSDLDNALNLNQLLSRQIFGQQTAIDEIAQAVRISRAGIQAHDRPLGVFM
LSGPSGVGKTETAFALAEAMYGGAHNLIVFNMSEFQESHTVSTLKGAPPGYVGYGKGGKL
TEAVRRKPYSIVLLDEFDKAHPDIHEAFYQVFDKGVMEDGEGRMISFRQCFILMTSNIGA
GEIEATLAETPDLKTEALRPMLHDVLARFFPAALLARMNVIPYVPLSTEAITHIATKQIS
RLQQRLHKEVGVSLVLEGDIPGWIAKRISAHPSRGRAVESLLQQAILPPISNEVLQRKRT
GQELQNIQLMVENDSLSVYFD
NT seq 2586 nt   +upstreamnt  +downstreamnt
gtgtatcaacgagaacgtcttttttcgcgattgggccactttgcctatcagtcgttcgtc
gaagcgaccaagctgtgccgaaccttcaggcacgaatacgtggagctggaacactggctg
aaagtcctggtggacaaggagcgcggcgacctgccgctgatcctggcgcactacgccatc
aacagtcagcgcatcagcgatgcgttggatcgcattcttcataccttgccgaaccgcacg
aatgcggtggtggatctgtcgacgcaactggaaacggtggtggaaagagggctgctgatg
agccagctcgccgaaacgccgtccggcggggtgcgcaccattcatatcctggtcggcatt
ctgcaggatcccacgttgcagcgcagcctgtaccggctgagcgacgagttcaaaaaactg
ccgatcccgcagctgttcgacgattatccggcgattctggcggagtccgtcgagcatgag
gaagaggaagaagaggtctacagcgcccacggcgatgcgccggaggcgtccgagacggtc
gatattctcgataaatggtgcgccgatctgacccgccaggcgcgcgacggtgaaatcgac
ccggtgattggccgcgaagcggagctgcgccaggtgatcgacatcttgctgcgtcgccgg
cagaacaacccgattttggtgggcgaagccggggtcggcaaaacggcggtggcggaagcg
ctggcctgcaagatagcccaggggcaggtgccgccgctgctgcagggcgcccggctgctg
tctttggatctggggcgcatgcaggccggggcgagcatgaggggcgaattcgaatcgcgc
ctgaaagcgctgatcgacgccatcgcgcattcggcggtgccggtgatcctgttttgcgac
gaggcgcatacgctggtgggcgccggcgggcaggccggcaccggcgacgccgtcaacctg
ttgaaaccgatgctggccaggggggcgctgcgcatggtggcggcgacgacctggtcggaa
tacaaacagttcatcgagccggacgccgcgctgacgcgccgtttccagtacgtgttggtt
tctgaacccgacgaagagaatgcggtgaacatgatgcgcgccatcgccccgcattttgcg
cagcaccacagcgtcaagatccgcgagtcggcgctgcaggcggcggtgcatttgtcgctg
cgccatctgccgtcgcggcaactgccggacaaagccatcagcttgctggacaccgcctgc
gcgcgggtggcgctgagccagcatgcgctgcctgaaaaaatcgagtcgctcgaggccggg
ttggcggtgaagcgcaccgaaatgaacggcctgcaggaggaaagcaaattcgacgatctg
gcgctcagccgcatcactgaattgcagcagaccctcagcgatatggaaggcgaactggct
gcgctgcgtcagcggcaggcgcaggagcaacaggcggtcaccaccttgctcgacgcggag
cggcagtcgccggagcgcttgccgcagttggcctccgaactgggagccttgcaagacggc
ggcctgccgttggtgtatccgtgggtggatgaccgcgtcgtggcggaggtgttgtcggat
tggaccggcatccccaccggccgcatgctgcaaagcgatctggacaatgcgctcaatctc
aatcaactgctgagccgccagatattcggccagcagacggcgatcgatgaaatcgcgcag
gcggtgcgcatctcccgcgccggcattcaggcgcacgatcggccattgggcgttttcatg
ctgtccggcccgagtggcgtcggcaaaacggagaccgcgtttgcgctggcggaggcgatg
tacggcggcgcgcacaacctgatcgtcttcaatatgagcgagtttcaggaatcgcatacc
gtttccaccctgaaaggggcgccaccgggctatgtcggctacggcaagggcggcaagttg
accgaggcggtgcgccgcaaaccttattccatcgtcttgctcgacgaattcgacaaggcg
catcccgatatccacgaggcgttttatcaagtcttcgacaagggcgtgatggaagacggt
gagggccgcatgatcagcttccgccagtgtttcattttaatgacgagcaatatcggcgcc
ggcgaaatagaagcgacgctggcggaaacgccggatctgaaaaccgaagcgctgcggccg
atgctgcacgacgtgctggcgcgcttcttcccggcggcgctgttggcgcgcatgaacgtc
attccctacgtgccgctttctaccgaagcgataacccatatcgccaccaaacagatttcg
cgtttacaacagcgtttgcacaaagaagtgggcgtgtcgctggtgctggaaggcgacatt
ccaggctggatagccaaacgcatcagcgcccatccttcgcgcggcagagcggtcgagtcg
ctgctgcagcaggcgattttgccgcccatcagcaatgaagtgctgcagcgcaaacggacg
ggacaggaactgcagaatatccaactcatggtcgagaacgatagtttaagtgtttatttc
gactga

DBGET integrated database retrieval system