KEGG   Serratia marcescens WW4: SMWW4_v1c31550
Entry
SMWW4_v1c31550    CDS       T02448                                 

Gene name
tssG
Definition
(GenBank) type VI secretion protein, TssG family
  KO
K11895  type VI secretion system protein ImpH
Organism
smw  Serratia marcescens WW4
Brite
KEGG Orthology (KO) [BR:smw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smw02044]
    SMWW4_v1c31550 (tssG)
Secretion system [BR:smw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SMWW4_v1c31550 (tssG)
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: AGE18949
Position
complement(3403209..3404237)
AA seq 342 aa
MADMSLMRETALSLEQAPTPGAQSESAGQAEIRGLSNRQDFFELLRRIERAQPDAPRLGV
SNDRSRERLCITQPADMAFASREIASIVQRPKQVLIQARHFGMFAPYGPLPIHVTEHART
EVIARRNQAFQQFVGIVSQRFAVLHYRAWAQLKAMIGHEHDDDKNPFLRHLRQTVGVDTA
LTVNPHIQRLREAYPGTYLPGRRSLRQLNKMLAAYFAVPITITPRYAKWIDDGKQSGSQK
LGKLGSTRIGSRFFDAQYGAHIQIGPLGAPQYQQYQRGSRRLQALVSICHDFTSHQLMLD
VSLLIATEPGMAAQLGGKSLSKDSWLKPKTGTFRQLVYQSTT
NT seq 1029 nt   +upstreamnt  +downstreamnt
atggctgatatgtcgttgatgcgtgaaacggcgctctcgttggaacaggcgccgacgccg
ggggcgcaaagcgaaagcgcgggccaggccgaaatccgcgggctgtccaatcgacaggat
tttttcgagctgctgcggcgtatcgaacgcgcgcagccggatgcgccgcggctcggcgtc
tccaacgatcgcagccgcgaaaggctctgcattacccagccggcggatatggcgttcgct
tcgcgtgaaatcgcctctatcgtgcagcgccctaagcaagtgctgatccaggcgcggcat
ttcggcatgttcgccccctacggcccgctgccgatccatgtgaccgagcacgcgcgcacc
gaagtcatcgccagacgcaaccaggcgttccagcagttcgtcggcatcgtcagccagcgc
ttcgccgtattgcactaccgggcctgggcgcagctgaaggcgatgatcggccatgagcat
gacgatgacaaaaacccgttcttgcgccatttgcgccagacggtgggcgtcgatacggcg
ctgacggtgaacccgcatatccagcgcctgcgcgaggcgtaccccggcacttatctgccc
ggtcgccgctcgctgcggcagctcaacaagatgttggcggcctatttcgccgttcccatc
acgattacgccgcgctacgccaagtggatcgacgacggcaagcaaagcggcagccaaaag
ctgggcaagttgggcagcacgcgcatcggcagccgctttttcgatgcccagtacggcgcg
catattcagatcggcccgctgggggccccgcagtatcagcagtatcagcgcggcagccgg
cggctgcaggcgctggtgagcatctgtcatgactttacgagccatcagttgatgctggat
gtcagcctgctgatcgccacggagccgggcatggcggcgcagctgggcggcaagtcgctg
agtaaagacagctggctgaaacctaagacagggacgtttaggcagctggtttatcaatca
acaacttaa

DBGET integrated database retrieval system