KEGG   Serratia marcescens WW4: SMWW4_v1c31560
Entry
SMWW4_v1c31560    CDS       T02448                                 

Gene name
tssF
Definition
(GenBank) type VI secretion protein, TssF family
  KO
K11896  type VI secretion system protein ImpG
Organism
smw  Serratia marcescens WW4
Brite
KEGG Orthology (KO) [BR:smw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smw02044]
    SMWW4_v1c31560 (tssF)
Secretion system [BR:smw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SMWW4_v1c31560 (tssF)
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: AGE18950
Position
complement(3404230..3406071)
AA seq 613 aa
MFSERFLQLYNDELRYFREAGRQFASSHPQVAQHLGMHIDGVLDPFVERLLEGSAFLCTR
IQEKLNNEQPEFALQMLSRLAPLWYTPVPAIATVAIKPDLSFPQWHSQVDLPRGSRMTLN
DISLNNKPATFTTARHIKVQPVEISLAECEILPPHHLPDGAARHMQDCSAYVRICLTTHG
VLPVSELDLEPLHLTLAEDTVRANQLLAALLNRTLRIVLWAKSDDRPIVKVLPPGSLRLG
GVSDEEALLPTVVGELPGNRLMREYFAAPSRFFSLELHGVQDFLRQCERVHEFEILFALE
QRPLTLIGRVNARDFHLFATPVINLYRRHCSPVLLTDERTEHQLVVDRLNTSLYEIHSVK
QVKGMLPDGNPVIFSSLQADVQYDCEREPAGYTLHRRREPSPSKYNNPHLPNEDTFIAIS
PGKSGIDIDDITSLSVEALVCERHLVPAHLQQPHFQLETAMPIHQVEIVRYPSNPVAVPN
ISQAWQAIQMLASNPLRHARPDVQDCSALLRDWLSLFCHQDDSSQRKRIASIKNAWVEHH
FERNQGPGPLAWIRGAEIAVNLSANHHADHGAYLFGKILHHALSQYGDLNQTLSMKLLLD
GETHADWGALYYG
NT seq 1842 nt   +upstreamnt  +downstreamnt
atgttcagtgagcgctttctccaattatataatgatgagctgcgttattttcgcgaggcc
ggtcgtcagttcgcctcttctcatccccaggtcgcccagcatttaggcatgcatatcgac
ggcgtgctggatcctttcgttgagcgtctgttggagggctccgcgttcctttgcacccgc
atccaggaaaagctgaacaatgagcagccggaatttgccttgcaaatgctctcacgcctg
gcgccgctgtggtatacgccggttcccgcaatcgccaccgtcgcgattaagcccgatctc
tcttttccccagtggcacagccaggttgacctgccgcgcgggagccgcatgaccctcaac
gatatctcgctgaacaacaaacccgccacgttcaccacggcgcggcatattaaagtgcag
cccgttgagatttcactggcggaatgcgagattttgccgccgcaccatttgcctgacggc
gccgccagacacatgcaggattgctcggcctacgtcaggatatgcctgacgacgcacggc
gtgcttcccgtctcggagctggatctcgagccgctgcacctgacgctggcggaagatacg
gtgcgggccaatcaactgctggccgcgttgcttaatcgcaccttgcgcatcgtgctatgg
gcgaaaagcgacgaccggccaatcgtcaaagtcttgccgccgggcagcttgcgcctgggc
ggcgtcagcgatgaagaagccttgttgcccaccgtggtgggggaattgcccggcaaccgg
ctgatgcgtgaatacttcgccgcgccaagccgcttcttcagcctggagttgcatggcgtg
caggattttctgcgccaatgtgaacgcgttcacgagttcgagatcttgttcgcgctggag
caacgcccactcactctgatcggtcgcgtcaacgccagggattttcatcttttcgcgacc
ccggtcatcaacctgtatcgccgccattgctcgccggtgctgctgacggatgagcgcacg
gagcaccagctggtggtcgatcgtttgaacacctcgctgtatgagatacacagcgtaaaa
caggtgaaaggcatgctgcccgacggcaacccggtgattttctcttcgctgcaggccgac
gtgcagtacgactgcgagcgggagccggccggttatacgctgcaccgtcgccgggagccg
tcgccctccaagtacaacaatccgcacctgcccaacgaagataccttcatcgccatctcg
ccgggcaaaagcggcatcgacatcgacgacatcacgtcgctcagcgtcgaggcgctggtc
tgcgaacggcatctggtgccggcgcaccttcagcagccgcatttccagctggaaacggcg
atgccgatccaccaggtggagatcgtccgctacccgagcaacccggtcgcggtgccgaac
atcagccaggcgtggcaggcgattcagatgctggcctccaatcctctgcgccatgcgcgc
cccgacgttcaggattgttcggcgctgttgcgcgactggctgtcgttgttctgccatcag
gatgactccagccagcgcaagcgcatcgccagcatcaaaaatgcctgggtggagcaccac
ttcgaacgcaatcaggggccggggccgctggcctggatccgcggagccgagatcgccgtc
aacttaagcgccaaccatcatgccgaccacggcgcctatctgttcggcaaaatattgcac
cacgcgttgagccaatacggcgacctgaaccaaacgttaagcatgaagctgttgctggat
ggggaaacccacgccgactggggggcgctctactatggctga

DBGET integrated database retrieval system