KEGG   Serratia marcescens WW4: SMWW4_v1c31570
Entry
SMWW4_v1c31570    CDS       T02448                                 

Definition
(GenBank) hypothetical protein
  KO
K11897  type VI secretion system protein ImpF
Organism
smw  Serratia marcescens WW4
Brite
KEGG Orthology (KO) [BR:smw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smw02044]
    SMWW4_v1c31570
Secretion system [BR:smw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SMWW4_v1c31570
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: AGE18951
Position
complement(3406083..3406529)
AA seq 148 aa
MKASLPMLFDKLSVRHQSASADNWRRVLVRDIEFLLNDASRSADLKLHDYAHSESSVLNY
GLPSLSQRIPINTDPLTLARHIQRIITSFEPRLDPKTIRVVPVVNERQSYVLAILFDIYG
TCSLPGDEMLVNLRIALDYSCGAVHVFD
NT seq 447 nt   +upstreamnt  +downstreamnt
atgaaagcgtcattgcccatgctattcgataagctcagcgtgagacatcaaagcgccagc
gccgataattggcggcgtgttttggtgcgtgatatcgaatttttactgaatgacgcatcg
cgcagcgctgatttgaaacttcatgattatgcgcacagcgaaagttcggtattgaattat
ggcctgccgtcgctgagccaacgcataccgattaataccgatccgttaacgctggcgaga
catatacaaagaatcattacttcgtttgagccgcgtctggatccgaaaacgattcgtgtg
gtgcctgtagtgaatgaacgccaatcgtatgtgctggcgattttattcgatatttatggc
acctgctcattaccgggtgacgaaatgctggttaatttgcgcatcgctcttgattattcc
tgtggcgccgtacacgtatttgattaa

DBGET integrated database retrieval system