KEGG   Serratia marcescens WW4: SMWW4_v1c31600
Entry
SMWW4_v1c31600    CDS       T02448                                 

Gene name
tssB
Definition
(GenBank) type VI secretion protein, TssB family
  KO
K11901  type VI secretion system protein ImpB
Organism
smw  Serratia marcescens WW4
Brite
KEGG Orthology (KO) [BR:smw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smw02044]
    SMWW4_v1c31600 (tssB)
Secretion system [BR:smw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SMWW4_v1c31600 (tssB)
SSDB
Motif
Pfam: T6SS_VipA PRORP
Other DBs
NCBI-ProteinID: AGE18954
Position
complement(3408890..3409447)
AA seq 185 aa
MAKDSSSQKFIGKNNAPRVQIEYDVELYGSQKKVELPFVTGVMSDLSGHRKKPLLPIEER
KFLTFDQDNFNDRMRAIKPRLQFYVENTLSEDDALLDVELEFESMDDFTPGAIAKRVPQM
QRLLEAREHLTELITYMDGKSSAEEVVKNLLEKPDFLHRLVTDARKTVADAEQDVQDPGN
KGDEE
NT seq 558 nt   +upstreamnt  +downstreamnt
atggctaaggactcaagctctcagaaatttatcggtaaaaataacgcgccgcgcgtgcaa
attgaatatgacgtagagctttacggttcacaaaagaaagtggagttgccctttgttacg
ggggtcatgtccgatctctctgggcatcggaaaaagcctttgctgccgatcgaagagcgg
aaattcctgacctttgatcaggacaacttcaacgatcgcatgcgcgccatcaagcctcgt
ctgcaattttacgtagagaacaccctgagcgaagacgatgcgttgctggacgtggaattg
gagtttgaatcgatggatgacttcacgcctggcgccatcgccaaacgggttccgcagatg
caacgcctgcttgaagcccgggagcatctcacggagctgatcacctatatggatggtaaa
tccagcgcggaagaagtggtgaagaatctgctggagaaacccgattttctgcatcgtttg
gtgacggatgcgcgtaaaacggtcgcggatgcggaacaggatgtgcaggatcccggcaat
aaaggagatgaggaatga

DBGET integrated database retrieval system