KEGG   Serratia marcescens WW4: SMWW4_v1c31610
Entry
SMWW4_v1c31610    CDS       T02448                                 

Definition
(GenBank) ImpA domain protein
  KO
K11902  type VI secretion system protein ImpA
Organism
smw  Serratia marcescens WW4
Brite
KEGG Orthology (KO) [BR:smw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smw02044]
    SMWW4_v1c31610
Secretion system [BR:smw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SMWW4_v1c31610
SSDB
Motif
Pfam: ImpA_N
Other DBs
NCBI-ProteinID: AGE18955
Position
complement(3409472..3410437)
AA seq 321 aa
MNEVISTEVNGVEFDPRYSEIEFTLSEYDSQTDPLNAVDNARDINWHAIREQSAALLEQC
FDLHVVLWFMRANLHIDGFSAFYQGIKDIDAKYAEEGATIFPQADMEPSSDSFHAAALGW
LATSSCLHEIKNSKIFPDTPLTTDELLNMRLDEQEGKSLHFSEVVKVLGQADSYFAGRNL
PSLKEQLALEIDALERVENYANLQAEDYRLDCRQVRDYLKQFSRQLASLEQQELPAERDD
AEIDSPDADAPVAMPGKYIRSRQDVILLLDQVLDYFQNYEPSHPAPILIRRSQKMIGMDF
ATIVEELLPESLASLNQLSGK
NT seq 966 nt   +upstreamnt  +downstreamnt
atgaatgaagtcatctcaacggaagtgaatggcgtcgaatttgatccacgatacagtgaa
attgaattcacgctttcggaatatgacagtcaaaccgatccgcttaatgccgtagacaat
gcgcgtgatattaattggcacgccattcgcgagcagtctgccgcgttgctggaacagtgc
ttcgatttacatgtcgtgctgtggtttatgcgcgccaatcttcatatcgacggtttttcg
gccttctaccagggcattaaggatattgacgccaaatatgccgaggagggcgccaccatt
ttccctcaggcggacatggaaccctcatcggacagctttcatgcggccgcattagggtgg
ctcgccacatcgtcctgtctgcacgaaatcaagaacagcaagatttttcccgacacgccg
ttaaccaccgacgagctgctgaatatgcggcttgacgagcaggaaggcaaaagcctgcat
ttttcagaggtggtaaaggtgctggggcaagccgacagttattttgccggcagaaatctg
ccttcgctgaaagagcaattggcgctggaaatcgatgcgctggagcgcgtcgagaattac
gccaatctgcaggctgaagattatcgtttggactgccggcaggtacgcgactatttgaaa
cagttcagccgccagctggcttcactggaacagcaggaattgccggctgaacgggatgac
gcggagattgactcgccggatgctgacgcgcctgtcgccatgcccggcaaatatatccgt
tcccggcaggatgtcatcttgctgttggatcaggttttggactatttccaaaactatgag
cccagccatccggcccccattcttattcgacgttcacaaaaaatgatcggtatggacttc
gcgacgattgttgaggagcttttgccggaatctctggcctcgttaaatcaattgtccggg
aagtaa

DBGET integrated database retrieval system