KEGG   Serratia marcescens WW4: SMWW4_v1c41490
Entry
SMWW4_v1c41490    CDS       T02448                                 

Definition
(GenBank) type VI secretion system effector
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
smw  Serratia marcescens WW4
Pathway
smw03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:smw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SMWW4_v1c41490
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smw02044]
    SMWW4_v1c41490
Secretion system [BR:smw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SMWW4_v1c41490
SSDB
Motif
Pfam: T6SS_HCP Tra_M FtsK_SpoIIIE
Other DBs
NCBI-ProteinID: AGE19936
Position
4490932..4491414
AA seq 160 aa
MAIDMYMKVEGMTGESQDSNHKGWTDVLSFNWGASQPGNMAVGGGGGSGKVNYQDLRIQA
LIDKSTPAILKYCSSGKHVAKIELSVCKAGGNQVEYSKIVLEDVLVTQTDFNGVGQNDAI
LVDYAFQASKVTMSYWEQGSSGTKGAESKSGWDIKQNKES
NT seq 483 nt   +upstreamnt  +downstreamnt
atggcaattgatatgtatatgaaagttgaaggaatgacgggcgagtcccaagacagcaat
cataaaggatggaccgacgtactttcgtttaactggggcgcttcacagccaggaaatatg
gctgtcggcggtgggggcggttccgggaaagtgaattatcaagacctccgtattcaagcg
cttatcgacaaatctacacccgccattcttaaatattgttccagtggaaaacatgtcgcg
aaaatcgagctttccgtatgcaaagcgggcggcaaccaggtggaatattccaaaatcgtt
ctcgaagacgtgctggtgacgcaaaccgattttaatggtgtcggtcaaaatgatgcgatc
ctggttgattacgccttccaggcgtcaaaagtcaccatgagttactgggaacaaggcagc
agcggcactaaaggcgcggaaagcaaatctggttgggatatcaagcagaataaagagagc
taa

DBGET integrated database retrieval system