KEGG   Serratia marcescens WW4: SMWW4_v1c41500
Entry
SMWW4_v1c41500    CDS       T02448                                 

Definition
(GenBank) type VI secretion system effector
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
smw  Serratia marcescens WW4
Pathway
smw03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:smw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SMWW4_v1c41500
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smw02044]
    SMWW4_v1c41500
Secretion system [BR:smw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SMWW4_v1c41500
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AGE19937
Position
4491462..4491944
AA seq 160 aa
MAMDMFLKVEGINGESKNANHKQWIDVFSFNWGARQPGNMAVGGGGGTGKVNFRDLTVQA
LIDKATPALLKYCSAGKHLAKVQLSLCKAGGQEVEYTRITLEDVLVTHTDFIGVEHGSTL
GIEYSFQAGKVSMEYWEQAKQGNKGASVQMGWDIKQNKES
NT seq 483 nt   +upstreamnt  +downstreamnt
atggcaatggatatgtttttaaaagttgaaggcattaatggcgaatcgaaaaatgcgaat
cacaagcaatggatcgatgtcttttcctttaactggggcgcgcggcagcctggcaatatg
gccgttggcggcggcggcggtacgggtaaagtgaattttcgcgatctgaccgtacaggct
ctgatagataaagcgacacctgccttattgaaatactgttcggccggtaaacacctcgcc
aaggtgcagttgtcgctttgcaaagccggtgggcaggaagtggaatatacccgcattact
ctggaagatgtattagtgactcataccgacttcatcggtgtcgagcacggttccacgcta
ggcattgaatactcttttcaggccggtaaagtatcgatggaatactgggagcaagcgaag
caaggcaataaaggagcttcggtgcagatgggctgggacattaagcaaaataaagaaagc
taa

DBGET integrated database retrieval system