KEGG   Serratia marcescens WW4: SMWW4_v1c47960Help
Entry
SMWW4_v1c47960    CDS       T02448                                 

Gene name
yihX
Definition
(GenBank) alpha-D-Glucose-1-P phosphatase, anomer-specific
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
smw  Serratia marcescens WW4
Pathway
smw00010  Glycolysis / Gluconeogenesis
smw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMWW4_v1c47960 (yihX)
Enzymes [BR:smw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     SMWW4_v1c47960 (yihX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Acid_PPase HAD SHOCT Hydrolase_like Urocanase PNK3P Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: AGE20583
Position
complement(5198490..5199080)
Genome map
AA seq 196 aa AA seqDB search
MLYIFDLGNVIVDIDFKRVLGVWSNLSGTPLAVLSDRFAMGKVFQQHERGEISDEDFAGK
LCDEMGIALSFEQFATGWQAVFVALRPEVIDIMQRLRNEGHRVVVLSNTNRLHCNYWPQH
YPEVAAAADHLYLSQDLGMRKPEADIYQHVLAAENTAAADAVFFDDHPANVLAAQALGIK
TVHVTDRDVVPAYFAQ
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgctgtatatctttgatttaggtaatgtgatcgtcgatatcgatttcaagcgtgtgctg
ggcgtgtggagcaatttgagcggcacgccgttggcggtgctgtccgatcgtttcgccatg
ggtaaggtgttccagcaacatgagcgcggtgaaatcagcgatgaagacttcgccggcaag
ctgtgcgatgaaatgggcattgcgctcagcttcgaacaattcgccaccggctggcaggcg
gtatttgtcgcgctgcgcccggaagtgatcgacatcatgcagcgcctgcgcaacgaaggc
caccgggtggtggtgctgtcgaacaccaaccgtctgcactgcaactactggccgcagcac
tatcctgaagtggccgccgccgccgatcatctctatttgtcgcaagatctcggcatgcgc
aagccggaggccgatatctatcaacatgtgctggccgcggaaaacaccgccgccgccgac
gcggtgttcttcgacgatcacccggcgaacgtcctcgccgcgcaggcgctggggatcaag
acggtgcacgtcaccgatcgcgacgtggtgccggcctattttgctcaatga

DBGET integrated database retrieval system