KEGG   Sinorhizobium meliloti SM11: SM11_chr0146Help
Entry
SM11_chr0146      CDS       T01885                                 

Gene name
apaG
Definition
(GenBank) apaG
  KO
K06195  ApaG protein
Organism
smx  Sinorhizobium meliloti SM11
Brite
KEGG Orthology (KO) [BR:smx00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    SM11_chr0146 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AEH77432
UniProt: F7X731
Position
complement(157702..158094)
Genome map
AA seq 130 aa AA seqDB search
MYRALTRDIEVTVEPYYLEEQSDPDDSRYVWGYRIIIANHSGLAVRLMTRYWHITDENGQ
VDEVSGPGVIGEQPLLNPGDTYEYSSGCPLDTPSGVMFGHYSMEAEGGETFDVAIPAFSL
DSPGLVRTLN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgcgcgctgacacgcgacatcgaagtgacggtcgagccgtactacctggaagaa
cagtcggatcccgacgacagccgctatgtctggggctatcgcatcatcatagcgaaccat
tccggactcgcggtccggctgatgacccgctactggcacattaccgacgagaacggtcag
gtggacgaggtgagcggccccggcgtgatcggcgagcagccgctgctcaatcccggcgat
acctacgagtactcctccggctgcccgctggatacaccctccggcgtgatgttcggccat
tacagcatggaggcggaaggcggggagactttcgatgtcgccatccccgccttctcgctc
gattcgccgggcctcgtccgcacgcttaattga

DBGET integrated database retrieval system