KEGG   Sinorhizobium meliloti SM11: SM11_chr1222Help
Entry
SM11_chr1222      CDS       T01885                                 

Definition
(GenBank) Exodeoxyribonuclease V
  KO
K01144  exodeoxyribonuclease V [EC:3.1.11.5]
Organism
smx  Sinorhizobium meliloti SM11
Brite
KEGG Orthology (KO) [BR:smx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SM11_chr1222
Enzymes [BR:smx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SM11_chr1222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 UvrD_C_2 AAA_19 PIF1 Viral_helicase1 AAA_16 ATPase_2 TniB AAA_22 AAA_33 UvrD_C AAA TsaE ATPase SH3_13 AAA_28 PhoH NB-ARC NACHT AAA_11 AAA_5 AAA_18 AAA_24
Motif
Other DBs
NCBI-ProteinID: AEH78498
UniProt: F7X4R5
Position
1250244..1251371
Genome map
AA seq 375 aa AA seqDB search
MQFAPQQDEALKAVSQWLKGGRSQLFRLFGYAGTGKTTLARHFAENVDGEVVFAAFTGKA
AQVLRSKGATNAKTIHSLIYRPRGEEEVEDEETGKTSIAPMFAINRQSPVAKAALIIVDE
CSMVDEALGKDLMSFGTPILVLGDPGQLPPVSGGGYFTNHEPDFLLTDIHRQARDNPIIQ
LAMQVREGKEIMHGDYGTAQVISKGQVTQPLVLEADQVLVGTNRTRRRYNQRLRELKGFT
SEYPQSGDKLVCLRNDPAKGLLNGSLWQVMSSSKETVKPGINLMIRPEDDDMDRGAAKIK
LLKAAFEDVEGEIPWSTRKRYDEFDYGYALTVHKAQGSQWNNVVLFDESWAFRDTRERWL
YTAITRAAERLTIVR
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgcagttcgctccgcaacaggatgaggccctgaaggccgtttcgcaatggttgaaggga
ggccgttctcagctcttccggctgttcggctatgccggcaccggcaagaccacgctcgcc
cgccatttcgcagaaaatgtggatggcgaggtggtgttcgccgccttcaccggcaaggcc
gcgcaggtgctgcgctccaaaggagccacgaacgccaagaccatccactcgctgatctac
cgcccgcgcggcgaggaggaagtggaggacgaggagaccggcaagacgtcgatcgcgccg
atgttcgcgatcaaccgccagagcccggtcgcgaaagcggcgctgatcatcgtcgacgaa
tgctcgatggtggacgaggcgctcggcaaggatctgatgagcttcggcacgccgatcctc
gttctcggcgatcccggacaattgccgccggtttccggcggcggctacttcaccaatcac
gaaccggattttctcctgacggatatccatcgccaggcgagggacaaccctatcatccag
ctcgccatgcaggtgcgcgagggcaaggagatcatgcacggcgactacggcaccgcccag
gtcatctccaaggggcaggtgacacagcctctggtgctggaagccgaccaggtgctggtc
gggaccaacaggacgcggcggcgctacaaccagcggcttcgcgaactgaaaggctttacc
agcgagtatccgcagtccggcgacaagctcgtatgccttcgcaacgatccggccaaaggc
ctgctcaacggctcgctctggcaggtgatgagctcgtccaaggagacggtcaagccaggg
atcaacctgatgatccgcccggaagacgacgacatggatcgcggcgccgccaagatcaag
ctcctgaaggcggctttcgaggacgtcgagggcgaaatcccctggtccacgcgcaagcgt
tacgacgagttcgattacggctacgcgctgaccgtgcacaaagcccagggctcgcaatgg
aacaacgtcgtgcttttcgacgagagctgggctttccgcgatacgcgcgaacgctggctc
tacacggcgatcacacgcgccgcggagcggttgacgatcgtgcggtga

DBGET integrated database retrieval system