KEGG   Sinorhizobium meliloti SM11: SM11_chr3390Help
Entry
SM11_chr3390      CDS       T01885                                 

Gene name
phbA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
smx00071  Fatty acid degradation
smx00072  Synthesis and degradation of ketone bodies
smx00280  Valine, leucine and isoleucine degradation
smx00310  Lysine degradation
smx00362  Benzoate degradation
smx00380  Tryptophan metabolism
smx00620  Pyruvate metabolism
smx00630  Glyoxylate and dicarboxylate metabolism
smx00640  Propanoate metabolism
smx00650  Butanoate metabolism
smx00900  Terpenoid backbone biosynthesis
smx01100  Metabolic pathways
smx01110  Biosynthesis of secondary metabolites
smx01120  Microbial metabolism in diverse environments
smx01130  Biosynthesis of antibiotics
smx01200  Carbon metabolism
smx01212  Fatty acid metabolism
smx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:smx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SM11_chr3390 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    SM11_chr3390 (phbA)
   00640 Propanoate metabolism
    SM11_chr3390 (phbA)
   00650 Butanoate metabolism
    SM11_chr3390 (phbA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SM11_chr3390 (phbA)
   00072 Synthesis and degradation of ketone bodies
    SM11_chr3390 (phbA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SM11_chr3390 (phbA)
   00310 Lysine degradation
    SM11_chr3390 (phbA)
   00380 Tryptophan metabolism
    SM11_chr3390 (phbA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SM11_chr3390 (phbA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SM11_chr3390 (phbA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SM11_chr3390 (phbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:smx04147]
    SM11_chr3390 (phbA)
Enzymes [BR:smx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SM11_chr3390 (phbA)
Exosome [BR:smx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SM11_chr3390 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEH80625
UniProt: F7X1R1
Position
complement(3402504..3403685)
Genome map
AA seq 393 aa AA seqDB search
MSNPSIVIASAARTAVGSFNGAFGNTLAHELGAAAIKAVLERAGVEAGEVDEVILGQVLP
AGEGQNPARQAAMKAGLPQEKTAWGMNQLCGSGLRAVALGMQQIATGDAKVIVAGGMESM
SMAPHCAHLRGGVKMGDYKMIDTMIKDGLTDAFYGYHMGITAENVARKWQLTREEQDEFA
LASQNKAEAAQKAGRFADEIVPFVVKTRKGDVNVDQDEYIRHGATLDSIAKLRPAFDKEG
TVTAGNASGLNDGAAAALLMTEAEAARRGIQPLARIVSWATAGVDPQIMGTGPIPASRKA
LEKAGWSVADIELVEANEAFAAQACAVNKDLGWDPSIVNVNGGAIAIGHPIGASGARVLN
TLLFEMKRRGVSKGLATLCIGGGMGVAMCVERL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatccctcgatcgtcatcgccagcgcggctcgtacggccgtcggctccttcaac
ggcgccttcggcaatactctcgcgcacgaactgggtgcggccgccatcaaggcggtgctg
gagcgggctggcgtcgaagcgggcgaggtggacgaggtgatcctcggtcaggtgctgccg
gcgggcgaggggcagaatcctgcgcggcaagcggcgatgaaggccggtctcccgcaggaa
aagaccgcctggggcatgaaccagctttgcggctcgggcctgcgcgccgtagcgctcggc
atgcagcagatcgcaaccggcgatgcgaaggtcatcgttgccggcggcatggagtcgatg
tcgatggcgccgcattgcgcgcacctgcgcggcggcgtgaagatgggcgactacaagatg
atcgacacgatgatcaaggacggcctgacggatgccttctacggctaccacatgggcatc
accgccgagaacgttgcgcggaaatggcagctgacgcgcgaggaacaggacgaattcgcg
cttgcctcccagaacaaggcggaagcggcccagaaggccggccgtttcgccgacgagatc
gtgcctttcgtcgtgaagacgcgcaagggcgacgtaaacgtggatcaggacgagtacatc
cgccacggtgccacgctggattcgatcgcaaagctccgcccggccttcgacaaggaaggt
actgtgaccgcgggcaacgcttcgggtctcaacgacggtgccgccgcggcgctcttgatg
accgaggccgaggcggcccggcgcggcatccagccgcttgcccgcatcgtctcctgggcc
acggcaggcgtcgacccgcagatcatgggcaccggccccatccccgcatcgcgcaaggcc
ctcgaaaaggccggctggtcggtcgccgatatcgagctcgtggaggcgaacgaggctttc
gcggctcaggcctgcgccgtcaacaaggacctcggctgggatccttcgatcgtcaacgtc
aatggcggagcgatcgccatcggccatccgatcggtgcctccggtgcccgcgtgctgaac
acgcttcttttcgaaatgaagcggcgcggcgtctccaaggggcttgccaccctgtgcatc
ggcggcggcatgggcgtcgccatgtgcgtggaacgcctgtaa

DBGET integrated database retrieval system