KEGG   Sinorhizobium meliloti SM11: SM11_chr3404Help
Entry
SM11_chr3404      CDS       T01885                                 

Gene name
pyc
Definition
(GenBank) Pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
smx00020  Citrate cycle (TCA cycle)
smx00620  Pyruvate metabolism
smx01100  Metabolic pathways
smx01120  Microbial metabolism in diverse environments
smx01200  Carbon metabolism
smx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SM11_chr3404 (pyc)
   00620 Pyruvate metabolism
    SM11_chr3404 (pyc)
Enzymes [BR:smx01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     SM11_chr3404 (pyc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA CPSase_L_D2 Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl ATP-grasp Biotin_lipoyl_2 Dala_Dala_lig_C HlyD_D23 HlyD_3 Sulf_coat_C ATPgrasp_Ter ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AEH80639
UniProt: F7X1S5
Position
complement(3416123..3419581)
Genome map
AA seq 1152 aa AA seqDB search
MSISKILVANRSEIAIRVFRAANELGLKTVAIWAEEDKLALHRFKADESYQVGRGPHLPR
DLGPIESYLSIDEVIRVAKLSGADAIHPGYGLLSESPEFAEACAANGITFIGPKPETMRQ
LGNKVAARNLAISIGVPVVPATEPLPDDPEEIKRLAEEIGYPVMLKASWGGGGRGMRAIR
DPKDLIREVTEAKREAKAAFGKDEVYLEKLVERARHVESQILGDTHGNVVHLFERDCSIQ
RRNQKVVERAPAPYLNDAQRQELADYSLKIARATNYIGAGTVEYLMDSDTGKFYFIEVNP
RIQVEHTVTEVVTGIDIVKAQIHILDGFAIGAPESGVPRQEDIRLNGHALQCRITTEDPE
QNFIPDYGRITAYRGATGFGIRLDGGTAYSGAVITRYYDPLLEKVTAWAPNPGEAIQRMI
RALREFRIRGVATNLTFLEAIISHPKFHDNSYTTRFIDTTPELFQQVKRQDRATKLLTYL
ADVTVNGHPEVKGRPKPSDDIAAPVVPFTGGDVKPGTKQRLDQLGPKKFAEWVKAQPEVL
ITDTTMRDGHQSLLATRMRTYDIARIAGTYARALPNLFSLECWGGATFDVSMRFLTEDPW
ERLAMVREGAPNLLLQMLLRGANGVGYKNYPDNVVKYFVRQAAKGGIDVFRVFDCLNWVE
NMRVAMDAVAEEDRICEAAICYTGDILNSARPKYDLKYYTALAAELEKAGAHMIAVKDMA
GLLKPAAARVLFKALKEATGLPIHFHTHDTSGIAAATVLAAVESGVDVVDAAMDALSGNT
SQPCLGSIVEALSGSERDPGLDPEWIRRISFYWEAVRHQYAAFESDLKGPASEVYLHEMP
GGQFTNLKEQARSLGLETRWHEVAQAYADANRMFGDIVKVTPSSKVVGDMALMMVSQDLT
VADVENPGKDIAFPESVVSMLKGDLGQPPGGWPEALQKKALKGEEPYDARPGSLLEDADL
DAERKGIEEKLGREVTDFEFASYLMYPKVFTDYAVACETYGPVSVLPTPAYFYGMAPGEE
LFADIEKGKTLVILNQAQGEIDEKGMVKMFFEMNGQPRSIKVPDRNRGASAAVRRKAEAG
NAAHLGAPMPGVISTVAVASGQSVKAGDVLLSIEAMKMETALHAEKDGVISEVLVRAGDQ
IDAKDLLVVFGG
NT seq 3459 nt NT seq  +upstreamnt  +downstreamnt
ttgtccatttccaagatccttgttgccaaccgttccgaaatcgccatccgcgtcttccgc
gcggccaatgagctggggcttaaaacggtcgcgatatgggctgaggaggataagctggcg
ctgcaccgcttcaaggcggacgagagttatcaggtcggacgcgggccgcaccttccccgc
gacctcggaccgatcgagagctatctgtcgatcgacgaggtgatccgcgtcgccaagctc
tccggcgccgacgccatacatccgggctatgggctgctctccgaaagcccggaattcgcc
gaggcctgtgccgcaaacggcatcaccttcatcggccccaagccggagacgatgcgccag
ctcggcaacaaggtcgcggcccgcaacctcgcgatctcgatcggcgtgccggtcgtgccg
gcgaccgagcctctgccggacgacccggaagagatcaagcgactggccgaggagatcggc
tatccggtgatgctgaaggcctcctggggcggcggcggccgcggcatgcgggcgatccgc
gaccccaaggacctgatccgcgaggtgaccgaggccaagcgcgaggccaaggccgccttc
ggcaaggacgaggtctatctcgaaaagctcgtcgagcgcgcccgtcacgtcgaaagccag
atcctcggcgacacgcacggcaatgtcgtccatcttttcgagcgcgactgctcgatccag
cgtcgcaaccagaaggtcgtggagcgggcgccggcgccctatctcaatgatgcgcagcgc
caggaactcgcggattattcgctgaagatcgccagggcgaccaactatatcggcgcaggc
accgtcgagtatctgatggattccgataccggcaagttctacttcatcgaggtcaatccg
cgcatccaggtcgagcatacggtcaccgaggtcgtcaccggcatcgatatcgtcaaggcg
cagatccatattctcgacggcttcgccatcggtgcgccggaatcgggcgtgccgcgccag
gaggacatccgcctcaacggccatgcgctgcagtgccgcatcacgacggaagacccggag
cagaacttcattccggattatggccgcatcaccgcctatcgcggcgccaccggcttcggc
atccgcctcgacggcggcaccgcctattccggcgcggtgatcacccgttactacgatccg
ctgctcgagaaggtcaccgcctgggcgccgaacccgggcgaggcgatccagcggatgatt
cgtgcgctgcgagaattccgcatccgcggcgtggcgaccaacctcaccttcctcgaggct
atcatcagccacccgaagttccacgacaacagctatacgacgcgcttcatcgacacgacg
ccggaattgttccagcaggtcaagcgccaggaccgcgccaccaagcttctcacctatctc
gccgacgtcaccgtcaacggccatccggaagtcaagggccggccgaagccttccgacgat
atcgccgcgccggtcgtgccgttcaccggcggcgatgtgaagcccggcacgaagcagcgc
ctcgaccagctcggcccgaagaaattcgccgaatgggtgaaggcgcagccggaggtgctg
atcaccgacacgacgatgcgcgacggccaccaatcgcttctcgccacgcgcatgcgcacc
tacgacatcgcccgcatcgccggcacctatgcgcgggcgctgcccaacctcttttcgctc
gaatgctgggggggcgcgaccttcgacgtgtcgatgcgcttcctgaccgaagatccgtgg
gagcggctggcgatggtgcgcgagggtgcgccgaacctgctcctgcagatgcttctgcgc
ggcgccaacggcgtcggctacaagaactatccggataatgtcgtcaaatatttcgtccgc
caggccgcgaagggaggcatcgacgtcttccgcgtcttcgactgcctgaactgggtcgag
aacatgcgcgtggcgatggacgcggtggccgaggaggacaggatctgtgaggcggcgatc
tgctacaccggagacatcctcaattccgcccggccgaaatacgacctgaaatactacacg
gcgcttgcggccgagctggaaaaggccggcgcccacatgatcgccgtcaaggacatggcc
gggctcctgaagccggccgcggcgcgtgtgctcttcaaggcgctcaaggaagcgaccggc
ctgccgatccattttcacacgcacgacacttccggaattgcggcggcgaccgtgctcgcc
gcagtcgagtcgggcgtcgatgtcgtcgatgcggcgatggacgcgctctccggaaacacc
tctcagccctgcctcggctcgatcgtcgaagcgctgtccggctcggagcgcgacccgggt
ctcgatccggaatggatccgccgcatctccttctactgggaggcggtacgccatcaatat
gcggccttcgaaagcgacctcaaggggccggcttcggaagtctatctgcacgagatgccg
ggcggccagttcaccaacctgaaggaacaggcccgctcgctcggcctcgagacccgctgg
cacgaggtggcgcaggcctatgccgacgccaaccggatgttcggcgatatcgtcaaggtg
acgccgtcttccaaggtcgtcggcgacatggctctgatgatggtctcccaggatctgacg
gtcgccgatgtcgagaatccgggcaaggacatcgccttcccggaatcggtcgtctccatg
ctcaagggcgacctcggccaaccgccgggcggctggccggaggcgctgcagaagaaggcg
ctgaaaggcgaggagccctatgacgcgcgtccgggctcgctgctcgaagacgcggatctc
gacgccgagcgcaagggcatcgaggagaagctcggccgcgaagtgaccgatttcgagttc
gcctcctacctcatgtatccgaaggtcttcaccgattatgcggtggcctgcgagacctac
ggcccggtcagcgtgctgccgacgcccgcctatttctacgggatggcgccgggtgaggaa
ctcttcgccgacatcgagaagggcaagacgctcgtcatcctcaaccaggcgcagggggag
atcgacgagaagggcatggtcaagatgttcttcgaaatgaacgggcagccgcgttccatc
aaggtacccgaccgcaaccgcggcgcctcggctgccgtccgccgcaaggcggaagccggc
aacgccgcccatctcggcgcgccgatgccgggcgtgatctcgaccgttgcggtggcctcc
ggccaatcggtcaaggccggagacgtgctgctctccatcgaggcgatgaagatggagacg
gcgcttcacgccgagaaggacggggtgatttccgaggtgctcgtaagggccggcgatcag
atcgatgcgaaggatctgctggtggtgttcgggggttaa

DBGET integrated database retrieval system