KEGG   Sinorhizobium meliloti SM11: SM11_chr3658Help
Entry
SM11_chr3658      CDS       T01885                                 

Gene name
pit
Definition
(GenBank) probabable low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
smx  Sinorhizobium meliloti SM11
Brite
KEGG Orthology (KO) [BR:smx00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SM11_chr3658 (pit)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AEH80887
UniProt: F7X3V0
Position
complement(3721496..3722500)
Genome map
AA seq 334 aa AA seqDB search
MDATLAFPLLVGLIAVALFFDFLNGLHDAANSIATIVSTRVLRPQYAVFWAAFFNFIAFL
FFGLHVAETLGTGIIDPGIVTPQVIFAALMGAITWNIVTWVFGIPSSSSHALIGGLVGAG
LAKTGFSSIVWQGLLKTAGAIVMSPGIGFVLALLLVLIVSWLFVRQTPFAVDSTFRVLQF
VSASLYSLGHGGNDAQKTMGIIAVLLFSQGYLGSEFYVPFWVVITCQAAIALGTLFGGWR
IVHTMGSKITKLNPMQGFCAETGGAITLFAATWLGIPVSTTHTITGAIIGVGAARRVSAV
RWGLAGNIVVAWVITMPAAALISALCYFAADLVA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgacgctcgccttcccgctgctcgtggggctcatcgccgtcgcgcttttcttc
gacttcctcaacgggttgcacgacgcggccaattccatcgcaaccatcgtatcgacccgc
gtgctccggccgcaatatgcggtcttctgggcggcgttcttcaacttcatcgccttcctc
ttcttcgggctgcacgtcgccgaaacgctcggaaccggcatcatcgatccgggtatcgtc
acgccgcaggtgatcttcgcggcgctgatgggcgccatcacctggaacatcgttacctgg
gtcttcggcatcccgtcgagttcctcgcacgcgctcatcggcggtctcgtcggcgccggc
ctggccaagaccggtttcagttccatcgtctggcaaggcctgctgaagacggccggcgcc
atcgtcatgtcgccgggcatcggcttcgttctggcgctgctgttggtgctgatcgtctcc
tggctgttcgttcgccagacaccctttgccgtcgacagcaccttccgggtgctgcaattc
gtttcggcttccctctattcgctcggccatggcggcaacgatgcgcagaagaccatgggc
atcattgccgtgcttctcttctcgcagggctatctcggctcggaattctacgtgcccttc
tgggtggtcatcacctgccaggcggcgatcgcgctcggcacgctcttcggcggctggaga
atcgtccacacgatgggctcgaagatcaccaagctcaacccgatgcagggattctgcgcc
gagacgggcggcgccatcacgctgttcgccgcgacctggctcggcattccggtttcgacc
acccacacaatcaccggcgcgatcatcggcgtcggcgcggcgcggcgcgtatcggcggtg
cggtgggggcttgccggcaacatcgtcgttgcctgggtgatcaccatgccggcggcagcg
ttgatctcggcgctctgctatttcgccgcggacctcgtcgcctga

DBGET integrated database retrieval system