KEGG   Sinorhizobium meliloti SM11: SM11_chr3676Help
Entry
SM11_chr3676      CDS       T01885                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
smx00520  Amino sugar and nucleotide sugar metabolism
smx01100  Metabolic pathways
smx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:smx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SM11_chr3676 (nagA)
Enzymes [BR:smx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     SM11_chr3676 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3 FAD_binding_4
Motif
Other DBs
NCBI-ProteinID: AEH80905
UniProt: F7X3W8
Position
3740671..3741831
Genome map
AA seq 386 aa AA seqDB search
MTAKKTISGARIFDGIDWHDGAALVIEAGHVKAIAPAGSVPAGGETIDARGLLLVPGFID
LQVNGGGGALLNEKPSLESIRQICAAHAQFGTTALLPTLITDTRAVRTAAIAAGIEAKAA
AVPGFLGLHLEGPHLSVARKGAHDPALIRPMGDDDLAEILACAKALSRLMLTVAPENATK
EQVRALADAGVVVSLGHTDVDYDTACAYAKAGARTVTHLFNAMSGLGHREPGVVGAALST
GTLHAGMIADGFHVHPASMGIALRGKKGPGQIFLVTDAMSPIGTDQTSFFLNGREILRQG
GRLTLADGTLAGADIDMLSSVRFVHQKLGLPIEEAVRMASAYPADAMGIASHKGRLLPGT
DADFVLLTPELAMKSTWIGGETVFAA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgaagaagacgatcagcggagcgcggattttcgacggcatcgactggcacgac
ggggcagccctcgtgatcgaggcaggacacgtcaaggcgattgcgccggcgggaagcgtc
cccgccggtggcgagaccatcgacgcgcgtggcctgcttctcgtgcccggcttcatcgat
ctgcaggtgaacggcggcggcggcgcgcttctgaacgaaaagccgtccctcgaaagtatc
cggcagatctgcgcggcgcatgcgcaattcggcacgacggcgctgctgccgacgctgatc
accgacacgcgcgcggtcaggaccgcggccatcgccgcaggcatcgaggcgaaagccgcg
gcggttcccggcttcctaggcctgcatctcgaaggcccgcatctttccgtcgcgcgcaag
ggggctcacgatccggcgctgatccgtccgatgggcgatgacgatcttgccgagatactc
gcctgcgcaaaggcgctcagccgtctgatgctcaccgtggccccggaaaacgccaccaag
gagcaggtgcgggcgctggccgatgccggcgtcgtggtgagcctcggccataccgacgtg
gattacgacaccgcctgcgcctatgccaaagcgggtgcccggaccgtcacgcatctcttc
aacgccatgagcggactcggccatcgcgagcctggcgtggtcggcgcggcgctttcgacc
ggcacgctccacgccggcatgatcgccgacggttttcacgttcacccggcctcgatgggc
atcgcgctgcgcggcaagaaaggcccgggacagatctttctggtcaccgacgccatgtcg
ccgatcggcaccgatcagacgagcttcttcctgaacggacgggaaatcctgcgccagggc
gggcgcctgacgcttgccgacggcacgcttgccggcgccgatatcgacatgctttcgtct
gtccgcttcgtccaccaaaagcttggcctgccgatcgaggaggcggtccgcatggcctcc
gcctatcccgccgacgccatggggatcgcctcgcacaagggccggctcctgccgggtacg
gatgcggatttcgtgctgctcacgccggaactcgcaatgaaatcgacctggatcggcggg
gagacggtttttgcggcttga

DBGET integrated database retrieval system