KEGG   Sinorhizobium meliloti SM11: SM11_pD0768Help
Entry
SM11_pD0768       CDS       T01885                                 

Gene name
hexA
Definition
(GenBank) beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
smx00511  Other glycan degradation
smx00520  Amino sugar and nucleotide sugar metabolism
smx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smx00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SM11_pD0768 (hexA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SM11_pD0768 (hexA)
Enzymes [BR:smx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SM11_pD0768 (hexA)
Chaperones and folding catalysts [BR:smx03110]
 Intramolecular chaperones
  Others
   SM11_pD0768 (hexA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b E3_binding
Motif
Other DBs
NCBI-ProteinID: AEH83600
UniProt: F7XGC4
Position
pSmeSM11d:complement(817975..819894)
Genome map
AA seq 639 aa AA seqDB search
MLPVLYRLESAWQPDGGPFGRFTFSLFNLSGGPLSAFRLVYTSLTRVIDGAACENAVFLR
RNANFHEFAPPEGLTLAHGEHWTFTVNGLHREAKHCTDGAKSAYLTLADGSYVPVAVSDL
RLEGAVSELPPVRLPKGRLELPFALQPWPAEIDAAPGEAVPDVLYPAAESNADEVDAVSN
VLALFHRLFSAGHAPFSLAPSPQGLPIVFKKKAELEGEAYRLAFSDREIRLDYGAAAGRQ
YALTTLAQLIDGARNHGGDFRFPASGEIADRPRYGWRGCHLDVSRQFYPTADIVRLIDIL
AWFKLNIFHWHLTDDEAWRLEIKAYPTLTTLGVVRGPDEPMLPQLGNGAEPVGGFYSHAD
VKAIVAHAAALSIEVVPEIDIPGHSTAALVALPELSDGQEAPESYHSVQGYPNNALNPAI
PLTYEFLEKVFDEMVELFPSRYIHVGGDEVADGSWLASPLARKLMEQEGISGTFALQSYF
LKKVKQMLTARGRKLVGWNEVAHGGGVGTEGTLLMAWENPKVGIELAREGYDVVMTPGQA
YYLDMAQADAWQEPGASWAGTATPAHTYAYEAEGEFPEELKSRMKGVQACIWSEHFLSRG
YFNRLVFPRLPAIAEAAWTPKDKKDWLRFAAIAPLSPIL
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgctgccggttctctatcgcctcgaatctgcctggcaaccggatggcggtccgttcggg
cgcttcaccttcagcctcttcaatctatcgggcgggccgctcagcgccttccggctggtc
tacacctcgctcacccgcgtcattgacggggccgcttgcgaaaacgcggttttcctgcgc
cgcaacgccaatttccatgaattcgcgccgcccgaaggactgacgctcgcccatggcgaa
cactggacgttcaccgtcaatggtctgcaccgcgaggcgaagcattgcaccgacggggcg
aagtcggcctatctgacgctcgccgatggcagttatgttcccgtggcggtctccgacctt
cgtctcgaaggcgccgtgagcgagctgccgccggtacgtcttcccaaaggccggctcgag
cttcctttcgcgctgcagccctggcctgccgagatcgacgcggcgcctggagaagcggta
ccggacgtcctctatcccgcagcggaaagcaatgcggacgaggtcgatgccgtctccaac
gtcctcgctctattccatcggctgttttcggccggacacgctcccttcagtcttgcgccg
tccccgcaagggctgccgatcgtcttcaagaaaaaagcggagctcgaaggcgaggcctac
aggcttgccttttccgatcgggagatccggcttgattatggagcggcggccggcaggcaa
tatgccctgacgacgctcgcgcagttgatcgacggcgcgcgaaaccacggaggcgatttc
aggtttcccgcctccggcgaaatcgcggaccggccacgctatggctggcgcggctgtcac
ctcgatgtctcgcggcaattctacccgacggccgacatcgtgcggctcatcgatattctc
gcctggttcaagctcaacatcttccactggcacctgaccgacgatgaagcctggcggctg
gagatcaaggcctatccgacgctgacgacgctcggcgtcgtgcgcggcccggacgagcct
atgctgcctcaactcggcaacggcgccgaaccggtcggcggcttctacagccacgcggac
gtgaaggcgatcgtcgcgcatgctgccgcgctcagcatagaagtcgtcccggagatcgac
atacccggccacagcactgccgcgctcgtggcgcttcccgaactctccgatggccaggag
gcgccggaaagctaccactcggtccagggctatccgaacaatgccctgaacccggccatc
ccgctcacctatgaattcctagagaaggtgttcgacgaaatggtcgagctctttcccagc
cggtatatccatgtcggcggggacgaggtggccgacggctcatggctcgcgtcaccgctg
gcgcgaaagctcatggagcaggaagggatttccggcaccttcgcgctgcaatcctatttc
ctcaagaaggtgaaacagatgctgacggcgcgcgggcgcaaactcgttggctggaacgag
gtcgcgcatggcggcggcgttggaaccgagggcacgctgctgatggcctgggagaacccg
aaagtcggcatcgagcttgcgcgcgaaggctacgacgtcgtgatgaccccgggtcaggcc
tattatctcgacatggcccaggcggatgcgtggcaggagcccggcgcgagctgggccggc
acggcgacgccggcccacacctatgcctatgaggcggaaggagagttcccggaagagctg
aagagccggatgaagggagtccaggcctgcatctggtccgagcatttcctgtcgcgcggt
tatttcaaccgcctcgtctttccccggctgccggcaatcgccgaggcggcctggaccccg
aaggacaagaaggattggctgcgctttgccgcgatcgcgcccttgagccccattctgtga

DBGET integrated database retrieval system