KEGG   Sinorhizobium meliloti SM11: SM11_pD1220Help
Entry
SM11_pD1220       CDS       T01885                                 

Gene name
rbcL
Definition
(GenBank) putative ribulose bisphosphate carboxylaseoxygenase, large subunit protein
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
smx00630  Glyoxylate and dicarboxylate metabolism
smx00710  Carbon fixation in photosynthetic organisms
smx01100  Metabolic pathways
smx01110  Biosynthesis of secondary metabolites
smx01120  Microbial metabolism in diverse environments
smx01130  Biosynthesis of antibiotics
smx01200  Carbon metabolism
Module
smx_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:smx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SM11_pD1220 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SM11_pD1220 (rbcL)
Enzymes [BR:smx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     SM11_pD1220 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AEH84052
UniProt: F7XHM6
Position
pSmeSM11d:complement(1299533..1300789)
Genome map
AA seq 418 aa AA seqDB search
MLRITYRIETPGDVEFLAKKIASDQSTGTFVPVPGETEELKARVAARVLAIRHLEPADRA
SWPDEAGSATRFNRADAEIAFPLDAVGTDLSALMTIAIGGVYSIKGMTGIRIVDMKLPPE
FAAAHPGPQFGVVGSRRLTGVEGRPIIGTIVKPALGLRPEETAVLVGELLSSGVDFIKDD
EKLMSPAYSPLSARIAAIMPRILDHEQKTGKKVMYAFGISHTDPDEMMRNHDLVVAAGGN
AAVVNINSVGMGGVAFLRKRSGLVLHAHRNGWDILTRHGGLGMEFSVWQQFWRLLGVDQF
QINGIRVKYWEPDESFVKSFEAVSTPLFTKDDCPLPVVGSGQWGGQAPETYARTGHTTDL
LYLCGGGIVSHPGGPGAGVRAVRQAWEAAVAGIPLADYARDHPELAQSLEKFADGKGA
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtgctacgcatcacctaccgcatcgagaccccgggagatgtcgaattcctggcgaagaag
atcgcaagcgaccagtcgaccggaacgttcgtgccggttccgggcgaaaccgaagagctg
aaggcgcgggtggccgcgcgcgtactggctatccgccacctcgaacccgccgatcgggcc
tcatggccggacgaggcgggaagcgccacgcgcttcaaccgcgccgatgcggagattgcc
ttcccgctcgatgcggtgggaacggatctttccgccttgatgaccattgcgatcggcggc
gtctattccatcaagggaatgaccggcatccgcatcgtggatatgaagctgccgccggag
ttcgcggctgcgcatccgggtccgcagttcggtgtcgtcggcagccggcgcctgaccggt
gtcgaaggccgcccgatcatcggcacgatcgtcaagccggcgctgggtttgcggccagag
gaaaccgccgtactcgtcggcgagctgctttcctccggggtggatttcatcaaggacgac
gagaagttgatgagcccggcctattcgccgctgagtgcgcggatagcagccatcatgccg
agaatcctcgaccacgagcagaagaccggcaagaaggtcatgtatgccttcggcatatcc
cataccgatcccgacgagatgatgcgaaaccacgatctggtggtcgcggccggcggcaat
gcggcggtcgtcaacatcaattccgtcggaatgggcggcgtcgccttcctgcgcaagcgc
tccggcctcgtgctccacgcccatcgcaacggctgggacatcctcacgcgccatggcggt
ttgggaatggagttttcggtctggcagcagttctggcggctcctcggggtggatcagttc
cagatcaacggcatccgcgtcaaatactgggagcctgacgagagcttcgtgaagtccttc
gaggcggtgagcacgccgctctttaccaaggacgattgtccgctgccggtcgtggggtcg
ggccaatggggcggacaggcgcccgagacctatgcacggaccgggcacacgaccgatctg
ctctatctctgcggcggcggcatcgtcagccatccgggcggacccggcgccggcgtcagg
gccgtacgtcaggcctgggaggcggcagtcgccgggatcccgctggcggattatgccagg
gatcaccccgaactggcgcaatcgctcgaaaaattcgccgacggcaagggcgcctga

DBGET integrated database retrieval system