KEGG   Sinorhizobium meliloti SM11: SM11_pD1461
Entry
SM11_pD1461       CDS       T01885                                 

Definition
(GenBank) probabable dehydrogenase
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
smx  Sinorhizobium meliloti SM11
Pathway
smx00230  Purine metabolism
smx01100  Metabolic pathways
smx01120  Microbial metabolism in diverse environments
Module
smx_M00546  Purine degradation, xanthine => urea
Brite
KEGG Orthology (KO) [BR:smx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SM11_pD1461
Enzymes [BR:smx01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     SM11_pD1461
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AEH84293
UniProt: F7XIZ1
Position
pSmeSM11d:complement(1545889..1548207)
AA seq 772 aa
MNTYERIDRDLSDRDFTVVGKSVKRSDTLEKVTGTARYAGDVALPGMLHAKMKRSNIAHA
RIRSIDTSKALALKGVKAVLTHENVPRVLHAGSPHPRSASVTKDQYILDDRVRYWGEGVA
AVAAVSEEIAERAVALIEVEYEPLPGLFTIEAASVPGAPPIHENGLDRNQVLPPVFVTRG
DVDRGFAEADLILEREYDLGRPTPAYMEPNVCVSQWDGNGKLTMWTSTQSAFMVRGTLAE
VLGVPLNKVRVIVDHMGGGFGAKQDLFQNEFLCALLARQTGRPVKMEFSRKETFLGGRSR
HPGKIWLKQGFTKDGRIVAREARVTFNSGAYGSHGPGVTNVGTAALTSLYRCENVRLEGR
CIYTNSPIAGAFRGYGVVQTYYALDLMMDEAAEKLGFDPAEFKLMNAVRDGDIAPSGHPI
VGHGLGDCIRRVMEETNWHELRRREKPETVKRRGIGIGCEMHGSSAYPGIKEQGNAIVKM
NEDGTVTLITGTAGLGTGAHTALSQIVAEELGVPFEAVSVVQGDTDIVPWDIGAFASHTT
YLGGRAAQLAAADVRRQVLEHAAPMLKTEPENLAIRDGFVVVTNGSNRSIRVSEAVGPQR
GMPAVQLVGVGTYMPTKSYSFAAHFAEVEVDTETGEVAVLEVVPVHEIGRVIHPIAAAGQ
IEGGIQQGIGHTLSEDYVIDLTDGRSLNPSFVDYKMPLSMDMPSIRTIILETAPDPGGPY
GAKGVGEDPIIAIGPAIANAIYDAIGVRFHHYPITPEQVLNALKSKANETRQ
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgaacacatatgaaaggatcgatagagacctgtccgaccgggacttcaccgtcgtgggc
aagagcgtcaagcgttccgatactctggagaaggtcacggggacggccagatatgcaggc
gacgtcgccttgcccggcatgctccacgccaagatgaagcgcagcaacatcgcgcatgcg
cgcatcaggagcatcgacacgagcaaggcgctggcgctcaagggcgtcaaggcggtgctg
acgcacgagaacgtgccgcgcgttttgcatgcgggctcaccgcatccgcgctcggcatcc
gttaccaaggatcagtacatcctggatgacagggtgcgatattggggcgagggcgtcgcc
gcagtcgctgccgtcagcgaggaaatcgctgagcgcgcggtcgcgctcatcgaggtcgag
tacgagcccttgcccggcctcttcaccatcgaagccgcatcggtgcccggcgctccgccg
atccatgagaatggtctcgaccggaaccaggtgttgccgccggtcttcgtcacccgcggc
gacgtcgacaggggtttcgccgaagcggatctgatcctcgagcgcgaatacgatctcggc
cgcccgacaccggcctatatggagcccaatgtctgtgtcagccagtgggacggcaacggc
aagctcaccatgtggacctcgacccagagcgcattcatggtccgcggcacgcttgccgaa
gtgctcggcgtgccgctgaacaaggtacgcgttatcgtcgatcacatgggcggcggcttc
ggcgcgaagcaggatctgtttcagaacgagttcctctgcgccctgctcgcgcgacagacg
gggcgtccggtcaagatggagttcagccgcaaggaaacgttcctcggcggccgctcgcga
caccccggcaagatatggctgaagcagggcttcaccaaagacggccggatcgtcgcacgc
gaagccagggtcaccttcaactccggcgcctacggctcgcacggtccaggcgtcaccaat
gtcggcaccgcagcgctgacctcgctctaccgttgcgagaatgtccggctggaaggccgc
tgcatctataccaattcgccgatcgccggcgcctttcgcggctatggtgtggttcagacc
tactatgcgctcgacctcatgatggacgaggcggccgagaagctcggcttcgacccggcc
gagttcaagttgatgaacgcggtgcgcgacggcgacatcgcaccctccgggcatccgatc
gtcggacacggcctcggggattgcatccgccgcgtcatggaggagacgaactggcacgaa
ttgcgcaggcgggagaagccggaaaccgtcaagcgccgcgggatcgggatcggctgcgaa
atgcacggatccagtgcctatccgggcatcaaggaacagggcaacgcaatcgtgaagatg
aacgaggacggaacggtgacactgatcaccggcaccgccggcctcggcaccggcgcgcat
acagcgctttcgcagatcgtcgccgaggaactcggcgtgcccttcgaagccgtctcggtc
gttcaaggggacaccgatatcgtcccctgggatatcggtgccttcgccagccacacgacc
tatctcggcggacgggcggctcagctcgcggccgccgacgtgcgcagacaagtgctcgaa
cacgccgcgcccatgctcaagaccgagcccgagaatctcgcgatccgggacggtttcgtg
gtcgtcaccaacggctccaaccgcagcatccgggtttccgaggccgtcgggccgcaacgg
gggatgccggcggtgcaactagtcggcgtaggcacctacatgccgacgaagtcctactcc
ttcgccgcccatttcgccgaagtcgaggtggacaccgagaccggcgaggtggccgttctc
gaggtcgttccggtacatgagatcggcagggtcatccatccgatcgccgcggccggacag
atcgagggtggcattcagcagggcatcggccacaccctcagcgaggattacgtcatcgac
cttaccgacggacgttccctcaatccgagcttcgtcgattacaagatgcccctgtcgatg
gacatgccgtccatccgcaccatcatcctcgagacggcaccggatcccggcggtccctac
ggtgccaagggcgtcggcgaggatccgatcatcgcgatcgggcccgccatcgccaacgcc
atctacgacgccatcggcgtccgcttccaccactacccgataacgcccgagcaggtgttg
aacgctctcaagtccaaagccaacgaaacgaggcagtga

DBGET integrated database retrieval system