KEGG   Sphingomonas melonis: BJP26_05245Help
Entry
BJP26_05245       CDS       T04509                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
smy  Sphingomonas melonis
Pathway
smy00071  Fatty acid degradation
smy00072  Synthesis and degradation of ketone bodies
smy00280  Valine, leucine and isoleucine degradation
smy00310  Lysine degradation
smy00362  Benzoate degradation
smy00380  Tryptophan metabolism
smy00620  Pyruvate metabolism
smy00630  Glyoxylate and dicarboxylate metabolism
smy00640  Propanoate metabolism
smy00650  Butanoate metabolism
smy00900  Terpenoid backbone biosynthesis
smy01100  Metabolic pathways
smy01110  Biosynthesis of secondary metabolites
smy01120  Microbial metabolism in diverse environments
smy01130  Biosynthesis of antibiotics
smy01200  Carbon metabolism
smy01212  Fatty acid metabolism
smy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:smy00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BJP26_05245
   00630 Glyoxylate and dicarboxylate metabolism
    BJP26_05245
   00640 Propanoate metabolism
    BJP26_05245
   00650 Butanoate metabolism
    BJP26_05245
  Lipid metabolism
   00071 Fatty acid degradation
    BJP26_05245
   00072 Synthesis and degradation of ketone bodies
    BJP26_05245
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BJP26_05245
   00310 Lysine degradation
    BJP26_05245
   00380 Tryptophan metabolism
    BJP26_05245
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BJP26_05245
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BJP26_05245
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BJP26_05245
Enzymes [BR:smy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BJP26_05245
Exosome [BR:smy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BJP26_05245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AOW23045
UniProt: A0A175Y1H0
Position
1064481..1065659
Genome map
AA seq 392 aa AA seqDB search
MRSAVIVSTARTPIGRAYRGAFNNTTPQALAGHAIDHAVKRAGIDGGEVEDVVFGAALQQ
GHQAGNIARQAALRAGLPITVSGMSLDRQCASGLMAIATAAKQIVIDGMDVAIGGGVESI
SMVQTPQMRVAPDKQLLAMHNDIYMPMLQTAETVAKRYGIGREAQDAYGLQSQQRTAAAQ
AAGKFDDEIVPMAATMNVVDKVTKEVSTKDVTLSKDEGNRADTTLEGLQALQPVVGPDGV
ITAGNASQLSDGASASVLMEEKVAAAKGLTPLGRYVGMAVAGTKPDEMGIGPVFAIPKLL
EKNGLTMKDIGLWELNEAFAVQVLYCRDTLGIPDELLNVNGGAISIGHPYGMSGARMTGH
ALIEGKRRGAKYVVVTMCVGGGMGAAGLFEVL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccgccgtcatcgtctccaccgcccgcacgccgatcggccgcgcctatcgcggc
gccttcaacaacacgacgccgcaggcgttggccggccatgcgatcgaccatgccgtcaag
cgtgccggcatcgatggcggcgaagtggaggatgtggtgttcggcgccgcgcttcagcag
gggcatcaggcgggcaatatcgcgcgccaggcggcgttgcgcgccggcctgccgatcacc
gtgtcgggcatgtcgctcgaccgccagtgcgccagcggcctgatggcgatcgccaccgcg
gccaagcagatcgtgatcgacggcatggatgtcgcgatcggcggcggcgtcgagagcatc
agcatggtccagaccccgcagatgcgcgtcgcccccgacaagcagctgctcgcgatgcac
aacgacatctacatgccgatgctgcagaccgccgaaacggtcgccaagcgctacggcatc
ggccgcgaggcgcaggacgcctacggccttcaatcgcagcagcgcaccgccgcggcgcag
gcggcgggcaagttcgatgacgagatcgtgccgatggcggcgacgatgaacgtcgtcgac
aaggtgaccaaagaggtcagcaccaaggacgtcacgctgtcgaaggacgagggcaatcgc
gccgacacgacgctggaaggcttgcaggcgttgcagccggtcgtcggaccggacggcgtc
atcaccgcgggcaatgccagccagctgtcggacggcgcctcggcatcggtgctgatggag
gaaaaggtcgccgcagcgaaggggctgactccgctcggccgctacgtcggcatggcggtg
gcgggcaccaagcccgacgaaatgggtatcggcccggtcttcgcgatccccaagctgctc
gaaaagaacggcctgacgatgaaggacatcggcctgtgggaactgaacgaggcgttcgcc
gtccaggtcctctactgccgcgacacgctcggcattcccgacgaattgctcaatgtgaac
ggcggcgccatctcgattggacatccctacggcatgtccggcgcccgcatgaccggccac
gcgctgattgagggcaagcgccgcggtgcgaagtatgtcgtcgtcacaatgtgcgtcggc
ggcggcatgggcgcggcggggctgttcgaggtcctgtaa

DBGET integrated database retrieval system