KEGG   Sphingomonas melonis: BJP26_09385Help
Entry
BJP26_09385       CDS       T04509                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
smy  Sphingomonas melonis
Pathway
smy00030  Pentose phosphate pathway
smy00480  Glutathione metabolism
smy01100  Metabolic pathways
smy01110  Biosynthesis of secondary metabolites
smy01120  Microbial metabolism in diverse environments
smy01130  Biosynthesis of antibiotics
smy01200  Carbon metabolism
Module
smy_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
smy_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:smy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BJP26_09385
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BJP26_09385
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:smy04147]
    BJP26_09385
Enzymes [BR:smy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     BJP26_09385
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     BJP26_09385
Exosome [BR:smy04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BJP26_09385
  Exosomal proteins of colorectal cancer cells
   BJP26_09385
  Exosomal proteins of bladder cancer cells
   BJP26_09385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AOW23768
UniProt: A0A154NCQ4
Position
1989282..1990745
Genome map
AA seq 487 aa AA seqDB search
MQRNPVGKLLLFGATGDLAKRMLLPSLYGLHADGLLPKDLTITGSARGDMDDDGYRDVVK
KALDEFLPADRKDESALGTFMQRIQFQPADLSDPNSFQPLADKIGDVSGGLAIYLSTAPS
LFESAVQGLEKVGLTGPTVRIALEKPLGYDLASSKEINDTVASAFPEERTFRIDHYLGKE
TVQNILALRFGNSMFEPIWNAQGIDNVQITIAETVGLEDRAGYYEGAGALRDMVANHMLQ
LVALIAMEPPALYDGTAIRDEKAKVFRSMRKITPEQVPQCTVTGQYEEGAVGGKVVKGYD
DELGYDSNVETFVAIKAHIDNWRWQGVPFYLRTGKRMAKRRSEIAIQFKPVPHSMFSGRG
GVLQPNTLVIRLQPEEYIQLLVMTKEPGLDRDGLRLREVPLNLSLDAEFAGTRRRIAYER
LLLDLIEGDQTLFVRRDEVEAQWTWIDAIRAGWDANQTKPKHYAAGTWGPAGAIALTERD
GVTWQDD
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcaatcccgtcggcaagctgctcctgttcggagccaccggtgacctcgccaag
cgcatgttgctgccctcgctgtacggcctgcacgccgacggcctgctgcccaaggatctg
acgatcaccggctcggcgcgcggcgacatggacgacgatggctatcgcgacgtcgtgaag
aaggcgctcgacgaattcctccccgccgaccgcaaggacgaaagcgcgctcggcacgttc
atgcagcgcatccagttccagcctgccgatctgtccgaccccaacagcttccagccgctc
gccgacaagatcggcgacgtgtcgggcggcctcgccatctatctctcaaccgcaccctcg
ctgttcgaatcggcggtgcagggcctcgagaaggtcggactgaccgggccgaccgtgcgc
atcgcgctcgaaaagccgctgggctacgacctcgcctcgtcgaaggagatcaacgacacc
gtcgccagcgccttccccgaagagcggacgttccgcatcgaccattatctgggcaaggaa
accgtccagaacatcctggcgctgcgcttcggcaattcgatgttcgagccgatctggaac
gcgcaggggatcgacaacgtccagatcaccatcgccgagacggtgggtctggaggatcgc
gccggctattacgagggcgcgggcgcgctgcgtgacatggtcgccaaccatatgctccag
ctcgtcgcgctgatcgcgatggagccgccggcgctgtacgacggcaccgcgatccgcgac
gaaaaggccaaggtcttccgcagcatgcgcaagatcacgcccgagcaggtgccgcaatgc
accgtcaccggccaatatgaagaaggcgcggtcggcggcaaggtcgtcaagggctatgac
gacgaactgggctatgacagcaatgtcgaaaccttcgtcgcaatcaaggcgcatatcgac
aattggcgctggcagggcgtgcccttctacctgcgcaccggcaagcgcatggccaagcgc
cgcagcgagatcgcgatccagttcaagccggtgccgcactcgatgttctcgggccgcggc
ggcgtgctgcagcccaatacgctggtgatccgcctgcagccggaggaatatatccagctg
ctggtgatgaccaaggagccgggcctcgaccgcgacggcctgcgcctgcgcgaggtgccg
ctcaacctcagcctcgacgccgaatttgccggcacccgccgccgcatcgcctatgagcgc
ctgctgctcgacctgatcgagggcgaccagacgctgttcgtccgccgcgacgaggtggag
gcgcaatggacctggatcgacgcaatccgcgccggctgggatgcgaaccagaccaagccc
aagcattatgccgccggcacctggggccccgcgggcgcgatcgcgctgaccgagcgcgat
ggcgtgacctggcaggacgattga

DBGET integrated database retrieval system