KEGG   Sphingomonas melonis: BJP26_11060Help
Entry
BJP26_11060       CDS       T04509                                 

Definition
(GenBank) nitrilase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
smy  Sphingomonas melonis
Brite
KEGG Orthology (KO) [BR:smy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BJP26_11060
Enzymes [BR:smy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     BJP26_11060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase TetR_C_28
Motif
Other DBs
NCBI-ProteinID: AOW24043
UniProt: A0A175Y6Q3
Position
complement(2351183..2352052)
Genome map
AA seq 289 aa AA seqDB search
MRAAGSIRCSPADVTPVLIALLQMTSGIDPAVNAADLRHGIAAAKANGAGMVFAPEMAGL
LDRDRARAAASMRAEGDDPVLATVREAAAKAGLWVQLGSLAIRRDDGRLANRSFVIDDTG
AIRARYDKLHLFDADLPTGESWRESASYAPGDTAMVVDTPLGGMGLSICYDLRFAGLYAS
LAQAGATMLSIPAAFTRPTGAAHWHALLRARAIETGCFVVAAAQAGAHADGRATYGHSLV
VDPWGDVLLDMGEARGLGFAEVDPARVADVRARMPVLQHHRPIPPVVRA
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcggcgggctcgatccgctgctcgccggctgacgtcacccccgtgctgatcgcg
ctgttgcagatgacgagcgggatcgaccccgccgtcaacgccgcggacctgcgccacggc
atcgccgcggccaaggcgaacggcgcgggcatggtcttcgcgcccgagatggcgggcctg
ctggatcgcgatcgcgcgcgggcggccgcgtcgatgcgtgccgagggcgacgaccccgtg
ctggcaacggtgcgcgaagcggcggcgaaggcggggctctgggtgcaattggggtcgctg
gcgatccggcgtgacgacgggcggctcgccaatcgcagcttcgtgatcgacgacacgggc
gcgatccgcgcgcgctacgacaagcttcacctgttcgacgcggatctgccgacgggcgag
agctggcgcgaatcggcgagctatgcgccgggcgacaccgccatggtggtcgatacgccg
ctgggcggcatggggctgtcgatctgttacgatctgcggttcgcgggcctgtatgcctcg
ctggcgcaggcgggtgcgacaatgctgtcgatcccggcggcctttacgcgtccgaccggc
gcggcgcattggcacgcgctgctgcgcgcccgcgcgatcgagacggggtgtttcgtcgtc
gctgcggcgcaggcgggggcgcatgcggacggtcgcgcgacctatggccattcgctggtc
gtcgatccctggggcgacgtgctgctcgacatgggcgaggcgcgtgggctgggctttgcc
gaggtcgatccggcgcgcgtcgccgatgtgcgggcgcgcatgccggtgctgcagcatcat
cggcccattccgccggtggtccgggcgtga

DBGET integrated database retrieval system