KEGG   Stenotrophomonas maltophilia D457: SMD_0118Help
Entry
SMD_0118          CDS       T02061                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
smz00071  Fatty acid degradation
smz00072  Synthesis and degradation of ketone bodies
smz00280  Valine, leucine and isoleucine degradation
smz00310  Lysine degradation
smz00362  Benzoate degradation
smz00380  Tryptophan metabolism
smz00620  Pyruvate metabolism
smz00630  Glyoxylate and dicarboxylate metabolism
smz00640  Propanoate metabolism
smz00650  Butanoate metabolism
smz00900  Terpenoid backbone biosynthesis
smz01100  Metabolic pathways
smz01110  Biosynthesis of secondary metabolites
smz01120  Microbial metabolism in diverse environments
smz01130  Biosynthesis of antibiotics
smz01200  Carbon metabolism
smz01212  Fatty acid metabolism
smz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:smz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SMD_0118
   00630 Glyoxylate and dicarboxylate metabolism
    SMD_0118
   00640 Propanoate metabolism
    SMD_0118
   00650 Butanoate metabolism
    SMD_0118
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SMD_0118
   00072 Synthesis and degradation of ketone bodies
    SMD_0118
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SMD_0118
   00310 Lysine degradation
    SMD_0118
   00380 Tryptophan metabolism
    SMD_0118
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SMD_0118
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SMD_0118
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SMD_0118
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:smz04147]
    SMD_0118
Enzymes [BR:smz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SMD_0118
Exosome [BR:smz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SMD_0118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C DDE_Tnp_IS66_C
Motif
Other DBs
NCBI-ProteinID: CCH10720
Position
148485..149765
Genome map
AA seq 426 aa AA seqDB search
MPNARPVAILGGVRIPFCRQNTAYSDVGNLGMSVRTLGALVERFGLHGQQLGEVAMGAVI
KHSSDWNLGREATLSSGLSPLTPGITLQRACGTSLDSIITVANKIALGQIESGIGGGSDT
TSDVPIVYGKKLRARLLAANRAKSTGDKIRALTAGFKFSELKPEFPGVAEPRTGKSMGDH
CEDMAKEWNISRDSQDEWAVSSHKKLAAAYERGFFNDLIAPFRGVERDNILRPDTSLEKL
ATLKPAFDKVSGRGTLTAANSTPLTDGAAAVLLASEEWARAHGHEPQAYLRDAHVSAVDF
VHGEGLLMAPTIAVPEMLKRNGLTLQDFDIYEIHEAFAAQVLCTLRAWESEDYCRNRLGL
DAPLGRIDPDKINLLGSSLATGHPFAATGARVIATAAKQLAERGGGRALVSICTAGGMGV
VAIVER
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacgctcgtcccgtcgccatcctcggtggcgtccgcattccgttctgccgccag
aacaccgcgtattcggatgtcggcaacctcggcatgtcggtccgtacgctgggcgcgctg
gtcgaacgtttcggcctgcacggccagcagctgggcgaagtggcgatgggtgcggtgatc
aagcactccagcgactggaacctgggccgtgaggccacgctgtcctccggcctgtcgccg
ctgaccccgggcatcaccctgcagcgcgcctgcggcacttcgctggacagcatcatcacc
gtggccaacaagatcgcgctgggccagatcgaatcgggcatcggtggcggttctgacacc
acgtccgacgtgccgatcgtctacggcaagaagctgcgtgcacgcctgctggccgccaac
cgcgccaagagcaccggcgacaagatccgcgcgctcaccgccggcttcaagttctccgag
ctcaagcccgagttcccgggcgtggccgagccgcgcaccggcaagagcatgggcgaccac
tgcgaggacatggccaaggaatggaacatctcgcgcgactcgcaggatgagtgggcggtg
tcctcgcacaagaagctggccgccgcctatgagcgtggcttcttcaacgacctgatcgca
ccgttccgtggcgtcgagcgtgacaacatcctgcgcccggatacctcgctggaaaagctg
gccacgctgaagccggcgttcgacaaggtttccggccgtggcacgctgaccgctgccaat
tccaccccgctgaccgacggtgccgctgcggtactgctggccagcgaagagtgggcgcgc
gcgcacggccatgagccgcaggcctacctgcgcgacgcgcatgtctctgcggtggacttc
gtgcatggcgaaggcctgctgatggcgccgaccatcgcggtgccggagatgctcaagcgc
aatggcctgaccctgcaggacttcgacatctacgagatccacgaagccttcgccgcgcag
gtgctgtgcaccctgcgtgcgtgggagagcgaggattactgccgcaaccgcctggggctg
gacgcaccgctgggccgcatcgacccggacaagatcaacctgctgggttcgtcgctggcc
accggtcatccgttcgccgccaccggcgcccgcgtcatcgccaccgccgccaagcagctg
gccgaacgcggcggtggccgcgcgctggtgtcgatctgcaccgccggcggcatgggcgtg
gtggcgatcgtcgaacgctga

DBGET integrated database retrieval system