KEGG   Stenotrophomonas maltophilia D457: SMD_0316Help
Entry
SMD_0316          CDS       T02061                                 

Definition
(GenBank) Oxidoreductase
  KO
K05886  serine 3-dehydrogenase (NADP+) [EC:1.1.1.276]
Organism
smz  Stenotrophomonas maltophilia D457
Brite
KEGG Orthology (KO) [BR:smz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SMD_0316
Enzymes [BR:smz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.276  serine 3-dehydrogenase (NADP+)
     SMD_0316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase F420_oxidored RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: CCH10915
Position
368884..369636
Genome map
AA seq 250 aa AA seqDB search
MTRTVLITGATSGFGAAAVHRFAQAGWKVIATGRRGERLQPLVERYGKDVVHAAAFDIRD
PVAMEAALLALPPAFGEIDLLVNNAGLAQGTAPAQSARLSDWTTMIDTNITALVTLTHRL
LPQLVERKGAIINISSVAGVYPYPGGNAYGGTKAFVSQFSLGLRSDLHGTGVRVTTIEPG
MAETEFTVVRTHGDQNASDKLYSGANPMTAEDIAEQIFWVATLPPHLNINRLELMPVSQS
FAGFQVAREG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcactgtcctgattaccggcgccacatccggcttcggcgccgccgccgtccac
cgcttcgcccaggccggctggaaagtgatcgccaccggccgccgcggcgaacgcctgcaa
ccgctggtcgagcgctatggcaaggacgtggtgcacgccgccgccttcgacatccgcgat
ccggtggcgatggaggcggccctgctggcgctgccgccggccttcggcgagatcgacctg
ctggtcaacaacgccggtctggcgcagggcaccgcaccggcacagagcgccaggctgtcg
gactggaccacgatgatcgacaccaacatcaccgcgctggtgaccctgacccaccgcctg
ctgccgcagctggtggagcgcaagggtgcgatcatcaacatctcgtcggtggccggcgtc
tacccgtacccgggtggcaacgcctacggtggcaccaaggccttcgtcagccagttctcg
ctgggcctgcgttcggacctgcacggcaccggcgtgcgcgtgaccacgatcgagccgggc
atggccgagaccgagttcaccgtggtccgcacccatggcgaccagaatgcgtcggacaag
ctgtacagcggtgccaatccgatgaccgccgaagacatcgccgaacagatcttctgggtg
gccacgctgccaccgcacctgaacatcaatcgcctggagctgatgccggtcagccagtcc
ttcgccgggttccaggtcgcccgcgagggctga

DBGET integrated database retrieval system