KEGG   Stenotrophomonas maltophilia D457: SMD_1331Help
Entry
SMD_1331          CDS       T02061                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
smz00900  Terpenoid backbone biosynthesis
smz01100  Metabolic pathways
smz01110  Biosynthesis of secondary metabolites
smz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:smz00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SMD_1331 (dxr)
Enzymes [BR:smz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     SMD_1331 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Semialdhyde_dh Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: CCH11894
Position
complement(1490385..1491575)
Genome map
AA seq 396 aa AA seqDB search
MNAAADLRRVAVFGATGSIGASTLDVIARHPQRYQATVLAAGRQVQGLLALCRQHKPAHA
VIADESLFAELRDGLRDAGLATEAHAGHAALDQLAASDACDTVVAAIVGAAGLSSTLAAA
AAGKRILLANKESLVLAGELLTRTAERAGAEIIPIDSEHSAIFQCLRSRDASVDGAGVRR
ILLTASGGPFRGRSCAELAQVTPAQAVAHPKWSMGPKISVDSATLMNKGLEVIEAHHLFG
VPGERIEVLVHPQSLVHSLVEFVDGSTLAQMGLPDMRTTLAVGLGWPQRIESGVAGLDLL
AQGRLDFEAPDTDAFPCLALAWQAMQAGGTAPAVLNAANEEAVSAFLQGRIGFLTIPALV
ANALSTLPTQAADTLEVLLSADQRARQLTLNAIDAA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgctgcagacctgcgccgggtcgccgtattcggcgccaccggctcgatcggt
gcctccacgctggacgtgatcgcccgccacccgcagcgctaccaggcgaccgtgctcgcc
gccggacgccaggtgcaggggctgctggcgttgtgccgccagcacaaacccgcgcacgcg
gtgatcgccgacgaatcgctgtttgccgaactgcgtgacggcctgcgcgacgccggactg
gccaccgaagcccatgccggccatgccgcgttggaccagctggccgccagcgacgcctgc
gataccgtggtcgcggccatcgtcggcgctgccggcctgtcctcgaccctggccgcggcc
gccgccggcaagcgcatcctgctggccaacaaggaatcgctggtgctggccggcgaactg
ctgacccgtaccgccgaacgtgccggcgccgaaatcatcccgatcgacagcgaacacagc
gccatcttccagtgcctgcgctcgcgcgacgccagcgtcgacggcgccggcgtgcgccgg
atcctgctgaccgcctccggcggcccgttccgtggccgcagctgcgccgaactggcccag
gtcaccccggcccaggccgttgcccacccgaagtggtcgatgggaccgaagatctcggtc
gattcggcgacgttgatgaacaagggcctggaagtcatcgaggcccaccacctgttcggc
gtgcccggtgagcgcatcgaagtgctggtgcacccgcagagcctggtccattcgctggtc
gagttcgtcgacggctcgaccctggcgcagatgggcctgccggacatgcgcaccaccctc
gccgttggcctgggctggccacagcgcatcgaatcgggcgtggccgggctggacctgctg
gcccagggccggctggatttcgaggccccggacaccgacgccttcccctgcctggccctg
gcctggcaggccatgcaggccggcggcaccgcaccggcggtgctgaatgctgccaacgag
gaggcggtttcagcgtttcttcagggccggatcggtttcctgacgatcccggcgctggtt
gctaacgctctttcaacactgccgacgcaagcagccgatacactggaggtcctgttgtcc
gccgaccagcgggcacgccagctcaccctgaacgccatcgacgccgcctga

DBGET integrated database retrieval system