KEGG   Stenotrophomonas maltophilia D457: SMD_1728Help
Entry
SMD_1728          CDS       T02061                                 

Gene name
glk
Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
smz00010  Glycolysis / Gluconeogenesis
smz00052  Galactose metabolism
smz00500  Starch and sucrose metabolism
smz00520  Amino sugar and nucleotide sugar metabolism
smz00521  Streptomycin biosynthesis
smz01100  Metabolic pathways
smz01110  Biosynthesis of secondary metabolites
smz01120  Microbial metabolism in diverse environments
smz01130  Biosynthesis of antibiotics
smz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMD_1728 (glk)
   00052 Galactose metabolism
    SMD_1728 (glk)
   00500 Starch and sucrose metabolism
    SMD_1728 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    SMD_1728 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SMD_1728 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SMD_1728 (glk)
Enzymes [BR:smz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SMD_1728 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: CCH12274
Position
complement(1902690..1903697)
Genome map
AA seq 335 aa AA seqDB search
MSASSQPVLVADIGGTNARFALADTSLDAPLQKDSIREYAVAEFPSLGDAARHHLEQIGA
TASRGVFAVAGRVDGDEARITNHPWVISRSRTAAMLGFDELHLINDFAAQAMAISLLQPD
DVVQVGGAAWVPGKPGQPRNYAVIGPGTGLGVGGLIMRHGRCYPLETEGGHVSFPPGTPE
EIRILEILSEQFGRVSNERLICGPGLVNIHRAVCEMAGIDPGQLQPVDVTARALHGDPQA
MRTVDVFCAVFGAIAGDLVLTQGAWDGVFLTGGLTPKMLDSLQHSGFRQRFEHKGRFSSI
MARVPSLAVMHPHAGLLGAAAYAADAERDAPGVAA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgagtgccagctcgcagccagtgctggtcgccgacatcggtggcaccaacgcgcgcttc
gccctggccgacacctcgctggacgcaccgctgcagaaggacagcatccgcgagtacgcg
gtggcggagttcccgtcgctgggtgatgccgcgcgccaccatctggaacagatcggcgcc
acggcaagccgcggcgtgttcgccgtggccggtcgcgtggatggtgacgaagcacgcatc
accaaccatccgtgggtaatctcgcgcagccgcaccgctgccatgctcgggttcgacgaa
ctgcacctgatcaacgacttcgccgcacaggcgatggcgatttcgctgctgcagcccgat
gacgtggtccaggtcggcggggctgcctgggtaccgggcaagcccggccagccacgcaac
tacgcggtgatcgggcccggtaccgggctcggcgtcggcggcctgatcatgcgccacggc
cgttgctatccgctggaaaccgaaggcggccatgtgagcttcccgccgggaaccccggaa
gagatccgcatcctggagatcctgtccgagcagttcggccgcgtctccaacgagcgcctg
atctgcggccccggcctggtcaacatccatcgcgccgtgtgcgagatggccggcatcgat
ccgggccagctgcagccggtggacgtgaccgcccgcgccctgcacggcgatccgcaggcg
atgcgcaccgtggatgtgttctgcgccgtgttcggcgccattgctggcgatctggtgctg
acccagggcgcctgggacggcgtgttcctgaccggcgggctgaccccgaagatgctcgat
tcgctgcagcactccggtttccgccagcgtttcgagcacaagggccggttctcttccatc
atggcgcgcgtgccctcgttggcggtgatgcatccccacgccggactgctgggcgccgcc
gcctatgccgccgacgccgaacgtgacgcacctggagttgccgcatga

DBGET integrated database retrieval system