KEGG   Stenotrophomonas maltophilia D457: SMD_2990Help
Entry
SMD_2990          CDS       T02061                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
smz00260  Glycine, serine and threonine metabolism
smz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
smz01100  Metabolic pathways
smz01110  Biosynthesis of secondary metabolites
smz01130  Biosynthesis of antibiotics
smz01230  Biosynthesis of amino acids
Module
smz_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smz00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMD_2990 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SMD_2990 (trpA)
Enzymes [BR:smz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SMD_2990 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA TMP-TENI PcrB DUF561 Dus
Motif
Other DBs
NCBI-ProteinID: CCH13511
Position
complement(3308092..3308901)
Genome map
AA seq 269 aa AA seqDB search
MSVSRLDACFQRLREQQRKALIPFVTAGDPSLEATVPVMHALVDAGADVIELGVPFSDPM
ADGPTIQRSSERALARGAGSRYVLQAVAQFRERDAQTPVVLMGYLNPVEIHGYAAFAKAA
VDAGVDGVLLVDLPPEEAGDAQQAFDAAGLALVLLASPTTSEARADKLLALARGYLYYVS
FAGVTGASERLDSDAASARLQALRARASVPVVAGFGIKDAASAAAMARQADGVVVGSALV
AALAEAGSAEEAAQHARAFLAPLRQALDA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtatcccgactcgatgcctgtttccagcgtctgcgcgaacagcagcgcaaggcg
ctgatccccttcgtcacggccggtgatccctcgctggaggccaccgtgccggtcatgcac
gcactggtcgacgccggcgccgacgtgattgaactgggcgtgccgttctccgacccgatg
gccgatggcccgaccatccagcgcagctccgagcgcgcgctggcgcgcggcgccggcagc
cgctacgtcctgcaggccgtggcgcagttccgcgagcgcgatgcgcagacccccgtggtg
ctgatgggctacctgaacccggtggagatccacggttacgcggccttcgccaaggccgcc
gtcgacgccggcgtggacggcgtgctgctggtcgacctgccgccggaagaagcgggcgac
gcccagcaggcgttcgacgcagccggccttgcgctggtactgctggcgtcgccgaccacc
agtgaggcgcgagccgacaagctgctggcgctggcccgtggctatctctactacgtcagc
tttgccggtgtcaccggcgcgtccgagcgcctggacagcgatgccgccagtgcccgcctg
caggcgttgcgcgcgcgtgcgtcggtgccggtggtggcgggcttcggcatcaaggatgcc
gccagtgccgcggccatggcccgccaggccgacggcgtggtggtgggcagcgcgctggtg
gcggcgctggccgaagcgggctcggcggaagaggccgcgcagcacgcccgggccttcctc
gccccgctgcggcaggcgctggacgcgtaa

DBGET integrated database retrieval system