KEGG   Stenotrophomonas maltophilia D457: SMD_3933Help
Entry
SMD_3933          CDS       T02061                                 

Definition
(GenBank) Dihydrolipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
smz  Stenotrophomonas maltophilia D457
Pathway
smz00010  Glycolysis / Gluconeogenesis
smz00020  Citrate cycle (TCA cycle)
smz00620  Pyruvate metabolism
smz01100  Metabolic pathways
smz01110  Biosynthesis of secondary metabolites
smz01120  Microbial metabolism in diverse environments
smz01130  Biosynthesis of antibiotics
smz01200  Carbon metabolism
Module
smz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:smz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMD_3933
   00020 Citrate cycle (TCA cycle)
    SMD_3933
   00620 Pyruvate metabolism
    SMD_3933
Enzymes [BR:smz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SMD_3933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: CCH14441
Position
4401719..4403107
Genome map
AA seq 462 aa AA seqDB search
MSQTKNFNLPDLGEGLPDATIVEWFVKEGDVIKLDEPLVSMETAKAVVEVPSPFSGKVLK
LSGGAGDIIPTGSVLASFELDPNLPQRADGQDTGHSHGHAAPAAAPTPPPLPAAAAPAAA
EEAKPAAAERDDAGTVVGAMQSSNAVHAEQALAVGGVKAVPAVRAMARKLGVDLSRVAAT
GTDGAVTMADVKQAAANGSAKLGAAPAPVAAAAYAAPAPAQVSAPVQSEARTPLSAAGKP
MRTQPPGVVAKGQPEPLKGVRRNMARVMADAHSKVVPTTLNDDADIHAWLPGNDVTARLV
RSIVVAAQKVPAMNAWFDGEALTRTLHAQVDIGIAVDTDDGLFVPALRNADMLDARGIRE
GVNRLREQVESRSIAASELSGYTISLSNFGMFAGRYATPVVVPPCVAIVGAGRARHQMTP
VMGGVEAHKVIPLSVTFDHRAATGGEAARFLRAMMDDLALAS
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgagccagaccaagaacttcaacctgcccgacctgggcgaaggcctgccggacgcgacc
atcgtcgagtggttcgtcaaggaaggcgatgtgatcaagctggacgagccgctggtgtcg
atggagaccgccaaggccgtggtggaagtgccctcgccgttctccggcaaggtgctgaag
ctgtccggcggcgccggcgacatcatcccgaccggctcggtgctggccagcttcgaactg
gacccgaacctgccgcagcgagccgatggccaggacaccggccacagccatggccacgct
gcaccggcggccgcaccgaccccgccgccgctgccggctgcggccgctccggctgccgcc
gaggaggccaagcccgccgcggccgagcgcgatgacgccggtaccgtggtcggcgcgatg
cagagctccaatgccgtgcatgccgaacaggcgctggccgtcggtggcgtcaaggccgtg
ccggccgtgcgtgcgatggcgcgcaagctgggcgtggacctgagccgcgtggccgctacc
ggcaccgatggcgcggtgaccatggccgacgtcaagcaggctgccgccaacggcagcgcc
aagctcggcgctgctccggcaccggttgccgctgctgcctatgccgcgccggccccggcg
caggtgtctgccccggtgcagagcgaagcccgcaccccgctgtccgccgccggcaagccg
atgcgtacccagccgccgggcgtggtcgccaagggccagccggaaccgctgaagggcgtg
cgccgcaacatggcacgcgtgatggccgatgcgcacagcaaggtcgtgccgaccacgctg
aacgacgacgccgacatccacgcctggctgccgggcaacgacgtcaccgcgcgcctggtg
cgttcgatcgtggtcgccgcgcagaaggtgccggcgatgaacgcctggttcgacggtgaa
gcgctgacccgtaccctgcacgcgcaggtggacatcggcatcgccgtggacaccgacgac
ggcctgttcgtgccggccctgcgcaacgccgacatgctcgacgcacgcggcatccgcgaa
ggcgtcaaccgcctgcgcgagcaggtggaatcgcgttcgatcgcggcgtcggaactgagt
ggctacaccatctcgctgtccaacttcggcatgttcgccggccgctacgcgaccccggtc
gtggtgccgccgtgcgtggccatcgtcggtgccggccgagcccgccaccagatgaccccg
gtgatgggcggcgtggaagcgcacaaggtgatcccgctgtcggtcaccttcgaccaccgc
gcagccacgggtggtgaagctgcccgcttcctgcgcgcgatgatggacgacctggcactg
gccagctga

DBGET integrated database retrieval system