KEGG   Stackebrandtia nassauensis: Snas_0471Help
Entry
Snas_0471         CDS       T01194                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00780  Biotin metabolism
sna01100  Metabolic pathways
Module
sna_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:sna00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Snas_0471
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sna01007]
    Snas_0471
Enzymes [BR:sna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     Snas_0471
Amino acid related enzymes [BR:sna01007]
 Aminotransferase (transaminase)
  Class II
   Snas_0471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Aminotran_5 Beta_elim_lyase Aminotran_3 SHMT DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ADD40186
UniProt: D3Q4M6
Position
491759..492871
Genome map
AA seq 370 aa AA seqDB search
MIWQSTLDNKARLRRNAGLDRTLRVRAADDPLIDLAGNDYLGLARHPTVTAAAAEALAEY
GLGAGGSRLVRGTTDAHVALENRLGELLGGAALVYSSGYLANLGAIRALCDASTMLVRDA
HAHASLIDGCQLAGARLVTMPHNDIDALDRILAGHNRRSVVVVESVYSVDGDLAPLAELH
RVCRAHGAILLVDEAHAVGVLGPGGAGASAASGLKAASDLVITATLSKALGSAGGVVAGP
AELRRHLVDTGRTFIFDTAPPPAVAAGALAALELAAADDELRAEVSRRASAAAERLGVAA
PAAGVVSVPASDPHAALEWARRCAEAGVAVGCFRPPSTPDGSSRLRLTVNAGIPVADFNN
AIDVIERERP
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
gtgatctggcagtccaccctggataacaaggcgagactgcggcgaaacgccggtctcgac
cgcacgcttcgggtgcgcgcggcggacgatccgctcatcgacctggccgggaacgactat
ctcggactggcccggcacccgacggtgacggctgccgccgccgaggcgctggccgagtat
ggcctgggcgcgggcggttcccggctggtgcgcggcaccaccgacgcccacgtcgcgctc
gagaaccggctcggggaactgctcggcggtgcggcccttgtgtactcgtcgggctacctg
gccaacctcggcgccatccgggcgctgtgcgacgcgtccacgatgctggtgcgcgacgcg
cacgcccacgcctcgctcatcgacggctgccagttggcgggcgcccggctggtcaccatg
ccgcacaacgacatcgacgcactcgaccgcatcctcgccgggcataaccgacgatccgtg
gtcgtggtggagtcggtgtactccgtggacggtgacctggctccactcgcggaactgcac
cgggtgtgccgcgcgcacggcgcgatcctgctggtggacgaggcacacgccgtcggcgtg
ctggggcccggcggcgccggagcctccgccgcgtccggactgaaagccgcgtccgacctc
gtcatcaccgcgaccctgtccaaggccctggggtcggcgggcggcgtggtcgccggaccg
gccgaactgcgccgccacctcgtcgacaccggccgcaccttcatcttcgacaccgcgccg
ccgcccgccgtcgccgccggggcactggcggcactggaactggccgccgccgacgacgaa
ctgcgcgccgaggtgagccgtcgggcgagcgccgccgccgagcggctcggcgtcgcggcc
ccggcggcgggcgtggtgtcggtacccgcgtccgacccgcacgcggcactggaatgggcg
cgacgctgcgccgaggccggggtggcggtcggctgcttccggccaccatccacaccagac
ggatcctcccggttgcggctcaccgtcaacgccgggatccccgtcgcggacttcaacaac
gccatcgatgtgatcgaaagggagcgaccgtga

DBGET integrated database retrieval system