KEGG   Stackebrandtia nassauensis: Snas_0604Help
Entry
Snas_0604         CDS       T01194                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00020  Citrate cycle (TCA cycle)
sna00640  Propanoate metabolism
sna00660  C5-Branched dibasic acid metabolism
sna01100  Metabolic pathways
sna01110  Biosynthesis of secondary metabolites
sna01120  Microbial metabolism in diverse environments
sna01130  Biosynthesis of antibiotics
sna01200  Carbon metabolism
Module
sna_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sna_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Snas_0604
   00640 Propanoate metabolism
    Snas_0604
   00660 C5-Branched dibasic acid metabolism
    Snas_0604
Enzymes [BR:sna01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Snas_0604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ADD40318
UniProt: D3Q6R9
Position
638803..639981
Genome map
AA seq 392 aa AA seqDB search
MDLYEYQGRALFARHGVPVLDGGVAETVEEAVELAGKLDGRVVVKAQVKVGGRGKAGGVK
LADNVDEAREHATNILGMDIKGHTVHKVMLTVTADIDTEFYFSFLLDRANRTFLCIASTE
GGVEIEQVAAETPDKVLKLPINALTGVDATVAGEIADKAGFPADLRPQLVDMFVKLWETF
VSEDATLVEVNPLVRTPEGRALALDAKVTLDENAAFRHLDHAELEDKAAVDPLEQRAKEA
DLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEKHDNVKPANFLDIGGGASAAVMASGLE
VVLSDPAVKSVFVNVFGGITACDEVANGIVGALTMLAERGETVDKPLVVRLDGNNAELGR
SILDGANHPLVTRVDTMDGAADKAAELAAQGA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgtatgaataccaggggcgcgcgctgttcgcccggcacggcgtgccggtgctg
gacgggggcgtagccgagaccgtcgaggaggcggtcgagctcgccggaaagctcgatggg
cgagtggtcgtcaaggcgcaagtcaaggtcggcggccggggcaaggcggggggtgtcaag
ctcgccgacaacgtcgacgaggctcgtgaacacgccaccaacatcctcggcatggacatc
aagggacataccgtccacaaggtcatgttgacggtcaccgccgacatcgacaccgagttc
tacttctcgttcctgctggaccgtgccaaccgcaccttcctgtgtatcgcgtccactgag
ggcggtgtggagatcgagcaggtggccgccgagacgcccgacaaggtgctcaagctgccg
atcaacgccctgaccggcgtcgacgccaccgtcgcgggcgagatcgccgacaaggccgga
ttcccggccgacctcaggccgcagctggtcgacatgttcgtcaagctgtgggagaccttc
gtgtccgaggacgccaccctcgtggaggtcaacccgctggtgcgcacgcccgagggccgg
gcgctggcgctggacgccaaggtgaccctggacgagaacgccgcgttccggcacctcgac
cacgccgagctcgaggacaaggccgccgtcgacccgctggaacagcgcgccaaggaagcc
gacctcaactacgtcaaactggacggtgaggtcggcatcatcggcaacggcgccggactc
gtcatgtccaccctggacgtcgtcgcgtacgcgggcgagaagcacgacaacgtcaagccc
gccaacttcctcgacatcggcggcggcgcctccgccgcggtcatggcctcgggcctggag
gtcgtcctgtccgacccggccgtcaagagcgtcttcgtcaacgtcttcggcggcatcacc
gcctgcgacgaggtcgccaacggcatcgtcggcgcgctgaccatgctggccgaacgcggc
gagacggtggacaagccgctggtcgtgcggctggacggcaacaacgccgaactgggccgt
tcgatcctggacggcgccaaccacccgctcgtgacccgagtggacaccatggacggcgcg
gccgacaaggccgccgagctcgccgcgcagggagcgtga

DBGET integrated database retrieval system