KEGG   Stackebrandtia nassauensis: Snas_1558Help
Entry
Snas_1558         CDS       T01194                                 

Definition
(GenBank) Phosphoglycerate dehydrogenase
  KO
K16843  (S)-sulfolactate dehydrogenase [EC:1.1.1.310]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00270  Cysteine and methionine metabolism
sna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Snas_1558
Enzymes [BR:sna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.310  (S)-sulfolactate dehydrogenase
     Snas_1558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 AlaDh_PNT_C XdhC_C IlvN AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: ADD41261
UniProt: D3PWA4
Position
complement(1637429..1638403)
Genome map
AA seq 324 aa AA seqDB search
MANKRVLVTTAWLSPGDEVHRLLTDAGCDVVHSSFNDRDSSPATLAALVTGFDGIVAGTD
RFSAEVIAAADRLKVFGRTGVGYDNIDVAAATERGIAVCPTPGVNRQSVAEHTFALLLSV
ARGVPGNVTAVAAGDWPQVSGRELSGATLGLIGLGAIGKAVARIALGFGMRVIAHDPYLD
AEAVAASGVERASLDELLATADFVSLHIFLDDATRHLIDAEAIATMKPGAYLVNTSRGGV
VDETALAAALREGRLSGAGLDVLETEPLPPDSPLRGLDNLIITAHIGAATVESRARSGRM
AAQAVIDVLDGRTPEHVVNPEARR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacaagcgcgtactggtcaccaccgcgtggctgtcccccggcgacgaggtgcac
cggctgctcaccgacgccggttgcgacgtcgtccacagttccttcaacgaccgcgactca
tcccccgcgacactggccgcgctcgtgaccggcttcgacgggatcgtcgccggaaccgac
cggttctccgccgaggtcatcgccgccgccgaccggctgaaagtgttcggccgcaccggg
gtcggctacgacaacatcgacgtcgccgccgccaccgagcgcggcatcgcggtgtgcccg
acccccggcgtcaaccggcagtcggtggccgagcacaccttcgcgctgctgctgtcggtg
gccaggggcgtgcccggcaatgtcaccgcggtggcggcgggcgactggccgcaggtcagc
ggccgggaactgtcgggcgccaccctgggtctgatcgggctgggcgcgatcggcaaggcc
gtggcgcgcatcgcactgggcttcggcatgcgggtgatcgcccacgatccctacctggac
gccgaagccgtcgccgcgtccggtgtggagcgtgcgtcgctggacgaactgctggcgacc
gcggacttcgtgagcctgcacatcttcctcgacgatgcgacccggcacctgatcgacgcc
gaggccatcgcgacgatgaagccgggcgcctacctcgtcaacacctcccggggcggtgtc
gtcgacgagacggcactggcggcggcgctgcgcgagggcagactgtccggcgcgggcctg
gacgtcctggagaccgaaccgctgccgcccgacagtccgcttcgcggtctcgacaacctg
atcatcaccgcccacatcggagcggccacggtggagtcgcgggcccgatcaggacggatg
gccgcccaggccgtcatcgacgtcctcgacggacgcacccccgaacacgtcgtcaacccg
gaggcccggcgatga

DBGET integrated database retrieval system