KEGG   Stackebrandtia nassauensis: Snas_1818Help
Entry
Snas_1818         CDS       T01194                                 

Definition
(GenBank) glycine cleavage T protein (aminomethyl transferase)
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00260  Glycine, serine and threonine metabolism
sna00630  Glyoxylate and dicarboxylate metabolism
sna00670  One carbon pool by folate
sna01100  Metabolic pathways
sna01110  Biosynthesis of secondary metabolites
sna01130  Biosynthesis of antibiotics
sna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Snas_1818
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Snas_1818
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Snas_1818
Enzymes [BR:sna01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     Snas_1818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-ProteinID: ADD41514
UniProt: D3PYE7
Position
1906789..1908000
Genome map
AA seq 403 aa AA seqDB search
MSQTMNPAAALTSSAAVLNPEIMLYTRLRKSPYFWKSREHGVAMYSVYNHTYHPRHYGDP
VGEYWSLLNGVTIWDVGVERQVEISGPDAFAFTNMLVPRDLSKCKVGQCKYVFITAPDGG
IINDPVLLRLEENRFWLSLADSDVELWALGLAHAGGWNVEIKEIDVAPIQIQGPKSRELM
IDLFGKSILDLPYYYLNHYTLNGMEVVVSRTGYTAEIGYEIYLYNADHDAGKLWDTVWQA
GEPHGLRPVGPCHIRRIEAGMLAYGCDITRDTNPMEVGYDYKWMVDVDQESDFIGKAALK
RIRDEGISRIMCGVEIDGDPLGSYNDGSMIDRFAVYSGDGGKVGEVTSACYSPRLERNIG
LAMLDIGHSELGTKVGIVTPGGPRGGVVVPKPFIDPRKETPKG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagacaatgaatcccgcggcagccctcacgtccagcgcggctgtcctcaatccc
gagatcatgctgtacacgcgactgcgcaagtcgccctacttctggaaatcccgcgaacac
ggcgtggctatgtacagtgtgtacaaccacacctatcatccccggcactacggtgacccg
gtcggcgagtactggtcgctgctcaacggcgtcaccatctgggacgtcggcgtcgaacgc
caggtggagatctccggcccggacgccttcgcgttcaccaacatgctggtgccgcgcgat
ctgtccaaatgcaaggtcgggcagtgcaagtacgtcttcatcaccgctcccgacggcggc
atcatcaacgacccggtgctgcttcgccttgaggagaaccggttctggctgtcgctggcc
gacagcgacgtcgaactgtgggcactgggccttgcccacgcgggcggctggaacgtcgag
atcaaggagatcgacgtggccccgatccagatccagggcccgaagtcgcgcgagctcatg
atcgacctgtttggtaaatccattctggacctgccgtactactatctcaaccactacacc
ttgaacggcatggaggtcgtcgtcagccgtaccggctacacggccgagatcggctacgag
atctacctgtacaacgccgaccacgacgccgggaaactgtgggacacggtgtggcaggcc
ggggaaccgcacggactgcgcccggtcgggccctgccacatccggcgcatcgaggccggg
atgctggcctacggctgcgacatcacccgcgacaccaatcccatggaggtcggctacgac
tacaagtggatggtcgacgtggaccaggagtccgacttcatcggcaaggccgcgctcaaa
cgcatccgcgacgagggcatcagccggatcatgtgcggcgtcgagatcgacggcgacccg
ttgggcagctacaacgacggctccatgatcgacaggttcgccgtgtactccggcgacggc
ggcaaggtcggtgaggtcaccagcgcctgctactcgccgcgcctggaacgcaatatcggc
ctggccatgctcgacatcggacacagcgaactgggaaccaaggtcggcatcgtgacgccc
ggcggtccgcgcggcggcgtcgtggtccccaagccgttcatcgacccgcgcaaggaaacc
ccgaaggggtga

DBGET integrated database retrieval system