KEGG   Stackebrandtia nassauensis: Snas_1820Help
Entry
Snas_1820         CDS       T01194                                 

Definition
(GenBank) Formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00670  One carbon pool by folate
sna01100  Metabolic pathways
sna01120  Microbial metabolism in diverse environments
sna01200  Carbon metabolism
Module
sna_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:sna00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Snas_1820
Enzymes [BR:sna01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     Snas_1820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS
Motif
Other DBs
NCBI-ProteinID: ADD41516
UniProt: D3PYE9
Position
1908884..1910581
Genome map
AA seq 565 aa AA seqDB search
MTMPSDLDISRETVTLPLSDIAERCGIPASLTEPYGRFAAKVSLDAVAALSQRPRGKYVV
VTAITPTPLGEGKTTVTVGLGQGLNHIGKRAAIAIRQPSMGPTFGIKGGAAGGGYAQVVP
METINLHLTGDMHAVTAAHNLLAAMIDNHLHKGNSLGIDPHSVTWRRVLDVNDRDLRDIV
TGLGSRADGTPRQTGFDITAASEVMAILALSTSLADLRNRLGRIVIGFTADGAAVTAEDL
KAAGAMCVILRDALNPNLMQTVEGTPAFVHCGPFGNIAHGNSSIVADLIGLRSADYLVTE
AGFGADMGAERFFNIKCRASGLTPDAAVLVATVRGLKAHSGRYRIVAGRPLPPELLAENP
GDVEAGADNLRRQIANVRRHGVSPVVAVNAFDTDHDSEHRVIADIAAAEGAHVAISSHFT
RGGKGAAELAEAVVAACDEPGRFTPLYPDEASLTDKVETVAREIYGADGVDFAPAAAKRL
AAYESGGYGRLPVCIAKTHLSLSHDPALKGAPTGWRLPVREARLSAGAGFVYLVCGDMRT
MPGLSSAPAAERIDIDEQGRVVGLS
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgcccagtgacctcgacatatcccgcgagaccgtgaccctgccgctgtcggac
atcgccgagcgctgcgggatcccggcgtcgttgaccgaaccctacggccgcttcgccgcc
aaggtctcgctggacgccgtggcggcgctgtcgcagcggccgcgcggcaagtacgtggtg
gtcaccgcgatcacgcccaccccgctgggggagggcaagaccaccgtgaccgtcgggctg
ggccagggactcaaccacatcggcaaacgggcggccatcgcgatccggcagccgtccatg
ggcccgaccttcggcatcaagggcggcgcggccggtggcggctacgcccaggtggtgccg
atggagaccatcaacctgcacctgaccggcgacatgcacgccgtcaccgccgcccacaac
ctgctggcggccatgatcgacaaccacctccacaagggaaacagtctgggcatcgacccg
cactcggtgacctggcggcgggtgctggacgtcaacgaccgtgacctgcgcgacatcgtc
accggactggggagccgcgccgacggcaccccgcgccagaccggtttcgacatcaccgcc
gccagcgaggtcatggcgatcctggcactgtccacttcgctggccgacctgcgaaaccgc
ctggggcgcatcgtcatcggcttcaccgccgacggcgccgccgtcaccgccgaggacctc
aaagcggccggggcgatgtgcgtgatcctgcgcgacgccctcaaccccaacctgatgcag
accgtcgagggcacccccgcgttcgtgcactgcggaccgttcgggaacatcgcgcacggc
aactcgtccatcgtggcggacctgatcggactgcgcagcgccgactacctcgtcaccgag
gccggtttcggcgccgacatgggtgccgaacgcttcttcaacatcaagtgccgcgcatcg
ggtctcaccccggacgcggcggtcctggtggcgacagtccggggactcaaagcccacagt
ggccggtaccggatcgtcgccggacggccgctgccgcccgaactgctggccgagaacccc
ggcgacgtcgaggccggtgccgacaacctgcgccgccagatcgccaacgtccgccgccac
ggcgtgtccccggtggtggccgtcaacgccttcgacaccgaccacgacagcgaacaccgc
gtcatcgccgacatcgccgccgccgagggcgcgcacgtcgccatcagcagccacttcacc
cggggcggcaagggcgccgccgaactggccgaggcggtggtcgccgcctgcgacgaaccc
ggccggttcacgccgctgtaccccgacgaggcctcgctgaccgacaaggtcgagaccgtg
gcgcgcgagatctacggcgccgacggcgtcgacttcgcgcccgccgccgccaaacgcctg
gccgcctacgaatccggcggctacggacggctgccggtgtgcatcgccaagacgcacctg
tcgctgtcgcacgacccggcgctcaagggcgcgccgaccggctggcggctgccggtgcgg
gaggcgcggctgtcggcgggcgcgggcttcgtgtacctggtgtgcggcgacatgcgcacc
atgccgggcctgtcctcggccccggccgccgaacgcatagacatcgacgaacaaggacgg
gtggtgggcttgtcatga

DBGET integrated database retrieval system