KEGG   Stackebrandtia nassauensis: Snas_2509Help
Entry
Snas_2509         CDS       T01194                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sna01100  Metabolic pathways
sna01110  Biosynthesis of secondary metabolites
sna01130  Biosynthesis of antibiotics
sna01230  Biosynthesis of amino acids
Module
sna_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Snas_2509
Enzymes [BR:sna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Snas_2509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh His_biosynth IMPDH
Motif
Other DBs
NCBI-ProteinID: ADD42191
UniProt: D3Q616
Position
2648852..2649661
Genome map
AA seq 269 aa AA seqDB search
MSVLDEIVAGVAADVDTRRQLIPIEKIRAIAEKTPPALDAFSILREPGVGVIAEVKRSSP
SKGSLAEIPDPAELACEYAAGGARAISVLTEQNYFRGSLDDLDAVRAAVRIPVLRKDFII
SSYQVHEARAHGADLVLLIVAALEQNALVSLLERVESLGMTALVEVHDEVEADRALAAGA
RVIGVNARDLRTLKVDTSVFERVAPGLPNGVVKIAESGVREARDLLRYASVGADAVLIGE
GLVTKKSPREAVADMVTVGSHPSTPRPVR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgtgctcgacgagattgtcgccggagtcgccgccgacgtagacacacgccggcag
ctgattccgattgaaaagatccgtgccatcgcggagaagaccccacccgctttggacgcc
ttcagcatcctgcgggaaccgggcgtcggcgtcatcgccgaggtcaaacggtcttccccg
tccaagggttcgctggccgagatccccgatccggccgaactcgcctgcgagtacgccgcc
ggcggcgcccgcgccatcagcgtgctgaccgagcagaactacttccggggcagtctggac
gacctggacgcggtgcgcgccgcggtgcgcatcccggtactgcgcaaggacttcatcatc
tccagctatcaggtgcacgaggcccgcgcccacggcgccgacctggtgctgctgatcgtg
gcggccctggagcagaacgccctggtgtcgctgctggagcgggtcgagtcgctgggcatg
accgcgctggtcgaggtccacgacgaggtcgaggccgaccgggcgctggccgccggggcc
cgggtcatcggcgtcaacgcccgcgacctgcgcaccctcaaggtcgacacctcggtgttc
gaacgcgtcgccccgggcctgcccaacggcgtcgtcaagatcgccgagtccggggtgcgt
gaggcccgcgacctgctgcggtacgcctccgtcggcgccgacgccgtgctcatcggcgaa
ggcctggtcaccaagaaatcgccgcgcgaggccgtggccgacatggtcaccgtcggcagc
cacccctcgacgccaaggcccgtgcgatga

DBGET integrated database retrieval system