KEGG   Stackebrandtia nassauensis: Snas_2715Help
Entry
Snas_2715         CDS       T01194                                 

Definition
(GenBank) cytochrome P450
  KO
K17476  pentalenolactone synthase [EC:1.14.19.8]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna01100  Metabolic pathways
sna01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sna00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00999 Biosynthesis of various secondary metabolites - part 1
    Snas_2715
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:sna00199]
    Snas_2715
Enzymes [BR:sna01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.8  pentalenolactone synthase
     Snas_2715
Cytochrome P450 [BR:sna00199]
 Cytochrome P450, bacteria type
  CYP161 family
   Snas_2715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: p450 YdfA_immunity
Motif
Other DBs
NCBI-ProteinID: ADD42391
UniProt: D3Q7C0
Position
complement(2854392..2855573)
Genome map
AA seq 393 aa AA seqDB search
METPTLPFERTKVLELSPLARKLQEAGPIHRIRTAVGDPAWLVTRYAEVKELFGDNRLGR
SHPDPASASRMNHSAVFGGGPTGEFDTEPEDAVRFRRLLQPLFSAKHMRLMQSRVDELVS
GLLDPLEGATEPVDLHQALALPLPVLVICELLGVPLDDRDAFVAWSQDAGVVDDQARSEA
GMANLMGYIYQLAMKKRANPGKDVLSAVAAAEHLPDEEVTRLGAGLLFAGHETTVTRIGF
GVFLLLTKPEQWQSMLEDPELMSTAVEEILRAPVAGGLEGIPRYARSDIEFAGVTIKAGD
LVILDLSAANHDPRAFADPDEFDVSRPANTHVGFGHGLHYCIGAPLARIELRSVFAQLPR
RFPNLRLAVAPEDIEWRENQLTGGLKALPVSLT
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaaacccctaccctcccctttgaacggaccaaagtactcgaactttcacccctggcc
cgcaagcttcaggaagccggacccatccacaggatccgcaccgctgtaggcgaccccgcc
tggctggtcacccgttacgccgaggtcaaggagctgttcggcgacaaccggctgggccgt
tcccatcccgacccggcgtccgcctcccggatgaaccactccgccgtcttcggcggtggt
cccaccggagagttcgacaccgaacccgaagacgccgtgcggttccggcggctgttgcag
ccactgttctccgccaagcacatgcgtctcatgcagtcgcgagtggacgagctggtcagc
ggcctgctcgatccgctggagggcgcgacggaaccggtcgatctgcaccaggcgctcgcg
cttccgttgccggtgctggtgatctgcgaacttctcggcgtgcccctcgacgaccgcgac
gcgttcgtggcctggagccaggacgccggggtcgtcgatgaccaggcccgctccgaggcc
gggatggcgaacctgatgggctacatctaccagctggccatgaagaagcgggccaacccg
ggcaaggacgtgctcagcgcggtggccgccgccgagcacctgcccgacgaggaggtcacc
cggctgggtgccgggctgctgttcgccggtcacgagacgacggtgacccggatcggtttc
ggggtcttcctgctgctcaccaaacccgagcaatggcagtccatgctggaggatccggag
ctgatgtcgaccgccgtggaggagatcctgcgggccccggtggcgggtggactcgagggg
atcccccgctatgcccgcagcgacatcgagttcgccggggtcacgatcaaggccggcgac
ctcgtcatcctcgacctctcggcggccaaccacgaccctcgggccttcgccgatcccgac
gagttcgacgtgtcccggcccgccaacacccacgtgggcttcggtcacggactgcactac
tgcatcggggctccgttggcgcgcatcgagttgcgctcggtgttcgcgcagctgccgcgc
cggttcccgaacctgcggttggcggtggctcccgaggacatcgaatggcgggagaaccaa
ctgaccggtggtctcaaggcgctgccggtctcgctgacctga

DBGET integrated database retrieval system