KEGG   Stackebrandtia nassauensis: Snas_2720Help
Entry
Snas_2720         CDS       T01194                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00860  Porphyrin and chlorophyll metabolism
sna01100  Metabolic pathways
sna01110  Biosynthesis of secondary metabolites
sna01120  Microbial metabolism in diverse environments
Module
sna_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Snas_2720
Enzymes [BR:sna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Snas_2720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ADD42396
UniProt: D3Q7C5
Position
complement(2858269..2859375)
Genome map
AA seq 368 aa AA seqDB search
MTGPLTGYTVAVTAQRRGEELAALLGRRGAKTVLAPVLRMVSLPDDQALRAATVELINDP
PDVTIATTGIGFRGWLAAAEGWGLGEALHAALGSGRVWCRGPKALGAVRAAGLREEWSAP
SECGWEVSERLRGEPLSGQRVAVQLHGDPSDDFTDTIRSGGGHAVPIPVYRWMLPTDITP
VRRLVDQVCLRRIDAVTFTSAPAVNALLRIAGDQRTELLAALRAPADDGGVMAAVVGPVT
AAPLTRDEVPVVMPERARLGSLARLVTAELPGRASRLTLASGHTVELRGHLVMVDGQVQP
LPPAPMAILRALSAAKGRVLTRTELLRCLPRGCDRHAVEMAVTRLRDGLGLRSCVQTVIK
RGYRLNLL
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaccgggccgctgaccggttacaccgtggccgtcacggcgcagcgccggggcgaggag
ctggcggcgctgttgggtcggcgcggcgccaagacggtgctggcgccggtgctgcggatg
gtgtcgctgcccgacgaccaggcgctgcgggccgcgacggtggagctgatcaacgatccg
cccgacgtcacgatcgcgaccaccggcatcggtttccggggctggctggccgccgccgag
ggctgggggctcggcgaggcgctgcacgccgcgctgggcagcggcagggtgtggtgccgg
ggccccaaggcgctgggggcggtgcgggcggcgggattgcgcgaggaatggtcggcgccc
agcgaatgcggctgggaggtgtcggagcggctgcgcggcgaaccgctgtcgggccaacgg
gtcgcggtccagttgcacggcgaccccagcgacgacttcaccgacacgatccgctccggc
ggcggccacgcggtgccgatcccggtgtaccgctggatgttgcccaccgacatcacgccg
gtgcggcggctggtggatcaggtgtgtctgcgccggatcgacgcggtcacgttcaccagc
gcgcccgccgtcaacgcgctgctgcgcatcgccggtgaccagcgcaccgaactgctggcc
gcgctgcgggccccggccgacgacggcggggtcatggccgccgtcgtcggcccggtcacg
gcggcgccgctgacgagagacgaggtgccggtggtgatgccggagcgggcgcggctgggt
tcactggcacggctggtgaccgccgagctgccgggccgggcgtcgcgactgacgctggcc
agcgggcacaccgtggagctgcgcggacatctggtgatggtggacggtcaggtgcaaccg
ctgccgcccgcgccgatggcgatcctgcgggcgctgtcggcggccaagggccgggtgctg
acccgcaccgaactgctgcggtgcctgccccggggctgtgaccggcacgcggtggagatg
gcggtcacccggctgcgggacggcctggggctgcgcagctgcgtccagaccgtcatcaaa
cgcggctaccggctgaacctgctgtga

DBGET integrated database retrieval system