KEGG   Stackebrandtia nassauensis: Snas_2769
Entry
Snas_2769         CDS       T01194                                 

Name
(GenBank) major facilitator superfamily MFS_1
Organism
sna  Stackebrandtia nassauensis
SSDB
Motif
Pfam: MFS_1 MFS_3 MFS_2 Sugar_tr
Other DBs
NCBI-ProteinID: ADD42445
UniProt: D3Q871
Position
2914465..2915718
AA seq 417 aa
MSVQIGQSADRRPLVGLLASTTLSITGNAIVAVAVPWVVYARTGSATVAGLAGAAAILPV
ALSSLFGGALIDRFGRTVCAVAADLCSAAAVAALPLLDSLVGLGTGLILTLVALGAVFDG
PGTAARESLRPDVARVTGTELTKVNAWGEAAESVGNMVGPGLGGILIAALGGFGALWVTV
ALFLASALLTVLAVPRTISPPPRPQPYLRAVAEGLKFVVREPGLRAVALTATIIVAFIAP
FESVVLNAHLQATGAASQYGLILTAFALGGLAGAVGYGFAAHRLTERGTLIASVSLVGLG
IAGFALLPPVPVMLALGLAVGVAAGPINPIAAVIMQRRTPERLRGRVIGSYTSLALAAGP
LGLLVMGPVVDTGGPATGFAVIGAGCLLAAVFAGTARGLRGGQTADEPDPTTKEGTT
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgagtgttcagatcgggcagagtgcggaccgccgtccgctggtcggtctgctcgcctcc
accaccctgtccatcaccggcaacgccatcgtcgcggtggccgtgccctgggtggtgtac
gcccgcaccggcagcgccaccgtcgccggactcgccggggcggcggcgatcctgccggtg
gcactgtcgtccctgttcggcggcgcgctgatcgaccggttcggacgcaccgtgtgcgcc
gtggccgccgacctgtgcagcgccgcggccgtcgccgccctgccgctgctggacagcctc
gtcggactgggcaccggcctgatcctcaccctggtcgccctgggcgcggtgttcgacgga
cccggaaccgccgcccgcgaatcgctgcggcccgacgtcgccagggtcaccggcaccgag
ctgaccaaggtcaacgcgtggggtgaggccgccgagagcgtcggcaacatggtcggcccc
ggcctgggcggaatcctgatcgccgcgctgggcggcttcggcgccctgtgggtcaccgtc
gccctgttcctggcctcggcgctgctgaccgtcctcgccgtgccccgcaccatctcgccg
ccgccgcgaccacagccgtacctgcgcgccgtggccgagggcctgaagttcgtggtgcgc
gaacccggactgcgggccgtggcgctgacggccacgatcatcgtcgcgttcatcgcgccc
ttcgaatcggtggtgctcaacgcccacctacaggccaccggcgccgcgagccagtacggg
ctcatcctcaccgccttcgccctcggcggcctcgccggcgccgtcggctacgggttcgcc
gcccaccggctcaccgaacgcggcaccctgatcgcctcggtttcgcttgtcggactgggc
atcgccggattcgcgctgctgccgccggtcccggtcatgctggcgctgggcctggccgtc
ggcgtcgcggccggaccgatcaaccccatcgccgcggtgatcatgcagcgccgcaccccg
gaacgactgcgcggccgcgtcatcggcagctacacctcgctggcgctggccgccgggcca
ctgggcctgctcgtcatgggcccggtcgtcgacaccggcggaccggccaccggtttcgcg
gtgatcggcgccggatgcctgctggcggcggtgttcgccggtaccgcccgtggactgcgc
ggcggccagaccgccgacgaacccgaccccaccacgaaggaaggcacgacatga

DBGET integrated database retrieval system