KEGG   Stackebrandtia nassauensis: Snas_3965Help
Entry
Snas_3965         CDS       T01194                                 

Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00220  Arginine biosynthesis
sna00250  Alanine, aspartate and glutamate metabolism
sna00471  D-Glutamine and D-glutamate metabolism
sna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Snas_3965
   00220 Arginine biosynthesis
    Snas_3965
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Snas_3965
Enzymes [BR:sna01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Snas_3965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: ADD43617
UniProt: D3PZT0
Position
4227183..4228103
Genome map
AA seq 306 aa AA seqDB search
MTAVDIPGLLADIATEVEPEIGRGTVADYIPALARVDIRRFGMAVANLDGSVHGVGDWRE
PFSIQSVSKAFTLALVLSRPDGDRVWRRVGREPSGNPFNSLVQLEYENGIPRNPFINAGA
LVVTDELGHDGDAAEALLAFLRAESGSDAVSVDAEIAASEAEHANRNLALGYLMASYGNM
RQELPDVVEQYIRQCSITMNCAQLARAGLFLARHGVRNDGNRLLTRSQAKRVNAVMLTCG
AYDAAGEFAFRVGLPGKSGVGGGILAVVPGRCAIAVWSPGLDARGNSVAGVAALDRFTTV
TGWSVF
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgactgctgtggacattcccggcctgctcgccgacatcgccaccgaggtggaacccgag
atcggacgcgggacggtcgccgactacatccccgccctggcgcgcgtcgacatccgacgg
ttcggcatggcggtggcgaatctggacggttcggtccacggcgtcggcgactggcgggaa
ccgttctcgatccagagtgtgtccaaggcgttcacactggcgctggtgctgtcgcgcccc
gacggcgaccgggtctggcgacgggtcggccgggaaccgtccggcaaccccttcaactcc
ctggtgcagctggagtacgagaacgggatcccgcgcaacccgttcatcaacgccggggca
cttgtcgtcaccgacgaactgggccacgacggcgacgccgccgaagcgctgctggccttc
ctacgcgccgagtccggttccgacgcggtgtcggtggacgccgagatcgccgcctccgaa
gccgagcacgccaaccgcaacctcgcgctcggctacctgatggcgtcctacggcaacatg
cggcaggaactgccggacgtcgtcgagcagtacatccggcaatgctccatcacgatgaac
tgcgcccagctcgcccgagccggactgttcctggcccggcacggcgtccgcaacgacggc
aaccgcctcctgacccgcagccaggccaaacgggtcaacgcggtgatgctcacctgcggg
gcctacgacgcggccggagagttcgccttccgcgtcggcctgccgggcaagagcggcgtg
ggcggcggcatcctggcggtggtccccggccgctgcgcgatcgccgtgtggagcccggga
ctggacgcccgaggcaactcggtggcgggcgtcgccgcccttgaccggttcaccaccgtc
accggctggtcggtgttctga

DBGET integrated database retrieval system