KEGG   Stackebrandtia nassauensis: Snas_5697Help
Entry
Snas_5697         CDS       T01194                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00860  Porphyrin and chlorophyll metabolism
sna01100  Metabolic pathways
sna01110  Biosynthesis of secondary metabolites
sna01120  Microbial metabolism in diverse environments
Module
sna_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Snas_5697
Enzymes [BR:sna01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Snas_5697
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Snas_5697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase B12-binding HTH_43 RRM_7
Motif
Other DBs
NCBI-ProteinID: ADD45327
UniProt: D3PXZ8
Position
6059738..6061321
Genome map
AA seq 527 aa AA seqDB search
MNDVHNLPGRVRFVGTGPGDPGLLTKRALDAIAVADLVVHDRNLPQQMLEAAQEHAGDNA
VFTVADATSTELIKDLITAAREGRNVARLLTGDAYPNATAQDEIAAILDTEVAVEVIPGV
SYASAVAGYAGMPPGGLRTLIDVDDVSQLDTTTLAAAIANGTLVLTSDVANLAVVRDNLR
ATGIDSATPVAVTGDVTGETQFTATSTVDTFVEAALGFAGRVVITIGKGVEDRNRLGWWE
NRPLYGWKVLIPRTKEQAGEMSDKLREYGAIPCEVPTIAVEPPRTPAQMERAIKGLVDGR
YAWIVFTSANAVKAIWEKFAEHGLDARAFGGLKIACVGDATAAKVRSFGIEPELLPTGEQ
SGTGLLEVFPPHDTILDPVSRVLLPRADIATEALSAGLQERGWEVDDVTAYRTVRASPPP
ADIRDAIKSGGFDAVLFTSSSTVRNLVGIAGKPHARTVVSVIGPHTAETATEFGLRVDAQ
PQHANMPSLVEALAEYAVALKKRMAEAPVKQRRGAKAQGPTALRFRS
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatgttcacaatctccccggacgtgtccgattcgtcggaaccggccccggagac
ccgggcctcttgaccaaacgggccctcgacgcgatcgccgtggccgatctggtggtgcac
gaccgcaatctgccgcagcagatgctggaggcggcgcaggagcacgcgggggacaacgcc
gtgttcacggtggccgacgcgacgtccaccgagctgatcaaggacctgatcaccgccgcc
cgcgagggccgcaacgtcgcccggctgctgaccggcgacgcgtaccccaacgcgaccgcc
caggacgagatcgccgcgatcctggacaccgaggtggccgtcgaggtcatccccggcgtc
agctacgcctccgccgtggccggttacgcgggcatgccgcccggcggcctgcgcaccctc
atcgacgtcgacgacgtgtcgcaactggacaccacgacgctggccgccgcgatcgccaac
ggcaccctggtgctcaccagcgacgtcgccaacctggccgtggtgcgggacaacctgcgc
gccaccggcatcgactcggccaccccggtcgcggtcaccggcgacgtcaccggcgagacc
cagttcaccgcgacctccacggtggacaccttcgtggaggcggcgctcggcttcgccggc
cgcgtcgtcatcaccatcggcaagggcgtcgaggaccgcaaccggctgggctggtgggag
aaccggccgctgtacggctggaaggtgctgatcccccgcaccaaggagcaggccggcgag
atgagcgacaagctgcgcgagtacggcgccatcccgtgcgaggtgccgaccatcgccgtc
gagccgccccgcactccggcccagatggaacgcgccatcaagggcctggtggacggccgc
tacgcctggatcgtgttcacctccgccaacgccgtcaaggccatctgggagaagttcgcc
gagcacggcctggacgcgcgcgccttcggcggtctcaagatcgcctgcgtcggcgacgcc
accgccgccaaggtccgctccttcggcatcgagccggagctgctgcccaccggcgagcag
tccggaaccggtctgctggaagtgttcccgccgcacgacaccatcctggacccggtctcg
cgggtgctgctgccgcgcgccgacatcgccaccgaggcactgtcggccgggttgcaggag
cgcggctgggaggtcgacgacgtcaccgcctaccggacggtgcgcgcctcgccgccgccc
gccgacatccgcgacgccatcaagtccggcggcttcgacgctgtgttgttcacctcatcg
tcgaccgtgcggaacctggtcggtatcgccggcaagccgcacgcccgcaccgtcgtgtcg
gtgatcggcccgcacaccgccgagaccgccaccgagttcggcctgcgtgtggacgcgcaa
ccgcagcacgccaacatgcccagcctcgtcgaggcgctcgccgagtacgcggtggcgctg
aagaagcggatggccgaggccccggtgaagcagcgtcgcggcgccaaggcgcagggtccg
accgcgctacggtttcggtcatga

DBGET integrated database retrieval system