KEGG   Stackebrandtia nassauensis: Snas_6070Help
Entry
Snas_6070         CDS       T01194                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sna  Stackebrandtia nassauensis
Pathway
sna00010  Glycolysis / Gluconeogenesis
sna00020  Citrate cycle (TCA cycle)
sna00620  Pyruvate metabolism
sna01100  Metabolic pathways
sna01110  Biosynthesis of secondary metabolites
sna01120  Microbial metabolism in diverse environments
sna01130  Biosynthesis of antibiotics
sna01200  Carbon metabolism
Module
sna_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sna00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Snas_6070
   00020 Citrate cycle (TCA cycle)
    Snas_6070
   00620 Pyruvate metabolism
    Snas_6070
Enzymes [BR:sna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Snas_6070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: ADD45694
UniProt: D3Q1B4
Position
6425580..6426989
Genome map
AA seq 469 aa AA seqDB search
MPKYEQFNLPDLAEGLVDAEIIKWLVSPGDTVTLNQPIVEVETAKALTEIPSPYAGQISK
LHGDEGTTVDVGQPLVTFDLDPDGSAPAEVAEEEEDTKVLVGYGPKKVSTKRRARKPSGS
APAAAQPAPVAEPARPVPAQAPAPQPPKAEPPAPAPAPALTATPQRIAVLAKPPVRKLAK
DLGVDLTTITGTGPSGSITRDDVQSATTQAAAQASPSVKAHQGLNAAPVGGEERIPIKGV
RKLTAQNMSHSAFTAPHVTEFLQLDVTATMEAVARLKTLPNFDGVKVSPLLLVAKAMLLA
AKRHPMINSSWDEAAQEIVVKHYVNLGIAAATPRGLIVPNVKNAESLSLRELAEALNALT
ATAREGKTPPADMSGGTMTITNVGVFGVDTGTPILPPGESAILAFGAVRDLPWVHEGQVV
PRKVTTLSLSFDHRIVDGELGSKFLADVGAFLADPGTRLLAWSLGSRTS
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaatacgagcaattcaatctgcccgacctggccgagggtctcgtcgacgcggag
atcatcaaatggctggtgtccccgggggacacggtgacgctcaaccagccgatcgtcgag
gtcgagacggccaaggcgctcaccgagatcccctcgccgtacgcgggtcagatcagcaag
ctgcacggcgacgagggaaccaccgtcgacgtggggcagccgctggtcaccttcgacctc
gaccccgacggctcggcgcccgccgaagtcgccgaggaggaggaagacaccaaggtgctg
gtgggctacggccccaagaaggtcagcacgaagcggcgggcccgcaagccctccggttcg
gcacctgccgcagcccagcccgccccggtcgcggaaccggcccgcccggtcccggcccag
gctccggctccgcagccgccgaaggccgaaccgccagctcccgctccggctccggccctc
accgcgaccccgcagcggatcgcggtgctggccaagccgccggtacgcaagctggccaag
gacctcggcgtcgacctgaccaccatcaccggcaccggcccgtccggttccatcacccgc
gacgacgtgcagtccgccaccacccaggcggcggcgcaggcatctccttccgttaaggcc
catcagggccttaacgcggcaccggtgggcggcgaggaacgcatcccgatcaagggcgtg
cgcaaactcaccgcgcagaacatgtcccacagcgcgttcacagcgccgcacgtcaccgag
ttcctgcaactggacgtcaccgcgaccatggaggccgtggcgcggttgaagacgctgccg
aacttcgacggcgtcaaggtgtcaccgctgctgttggtggccaaggcgatgctgctggcc
gccaaacggcacccgatgatcaattcgtcctgggacgaggcggcgcaggagatcgtggtc
aagcactacgtcaacctgggcatcgccgccgcgacgccgcgtgggctgatcgtcccgaac
gtcaagaacgccgagtcgctgtcactgcgggaactggccgaggcgctcaacgcgctgacc
gccaccgcccgcgagggcaagacgccgccggccgacatgagcggcgggacgatgaccatc
accaacgtcggcgtcttcggcgtcgacaccggtacgccgatcctgccgcccggcgagtcg
gcgatcctggccttcggcgcggtgcgcgacctgccgtgggtgcacgagggtcaggtggtc
ccgcgcaaggtcacgacgctgagcctgtccttcgaccaccgcatcgtcgacggcgagctg
ggctcgaagttcctggccgacgtcggcgccttcctggccgacccgggcacccggcttctg
gcctggagcttaggttctcggacctcgtga

DBGET integrated database retrieval system